Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

List of TcC hypervariable region (HVR) clusters: 171


HVR cluster Represent Length (AA) ↓ Number of TcC Related genus
(number)
Function / domains* Representative HVR sequence (with domain region underlined)
TCHC_041 G03156 294 2 Mycoavidus (1)
ND VPSEPDKRKITNIMDVTSEFKRDDASLLKNNVLSGFKLKPPLLENKYLADLKAGVGQVFLFSLSKYTVESGHSVVSLDMG
NLVAESMEMASGGDGREFINAFWAPQGGYVDVPIHPSKEEAKIVFTPDFSGCSLMVNQIQKEGREFYRFRHVEGSKERQQ
FFELNSKEEWGLGLAANMNYEDYGISQNQENTRGFAYAIYSEITGNWVINWQGQSNVSSSLTLDKKAIIFMPVPGQSAIE
PVVLATGSKKVDILNRRRTESFSGVPHEAAEQLSRRGSFMGRLGSFRADHHSNF
TCHC_042 G00368 293 6 Proteus (4)
Rahnella (2)
PTP_DSP_cys superfamily
(E-value: 2.72416e-17)
FAEKPNGFNWVRRADGGQHNFAGMSLFSVNENLDRKAEYLKNQGVRTVIALESNNYQASKEALNKQGITFILFPINDWHA
PSVNQLAAYNALVDEYSKTGKVATHCWGGMGRTGVFLASRLLHIGEENNAQNALLAARERYHDKSVEMKAQYN
ALARLSD
SIGLEPSVKVSSLQIHWDNQHGDDGMYADPGHQNAKKYAGVDENWMRSVAVSEAGMSEGVPDYKIFSPKLALKPKPVVAP
APVMNTQNDPLEGIPPFIPKSAAAPVNKTSLWSRFTSFVSGIFRRLFSFIRRK
TCHC_043 G03945 293 5 Proteus (3)
Shigella (1)
Burkholderia (1)
CNF1 superfamily
(E-value: 4.8453e-36)
MPNSSFSLLFASDDMKLQKGSITPLRNRGLFVGSNRESSETTLPFAISRFDSVDNNPVLREYRPELLKRGGDLYQSVHIF
KGSQVSSSESGSGTIGTYWGHKILSDNLTAIQVMSGRSGSVGISIRLDDIKEKNPIVITSGALSGCTMQYAVDKEKLYAV
HTGQKPGDDNWKTGIQGVNTIQHSFRALSGKNLSVSGNHNNDLIGTLSEFESSAITYLGKQGTRIDQVQENIAVFDYNNQ
HKVSRFEPRAGYSYALLARDAGKINVKVLSEDVIINQNTNKITVLDS
MKVRLH
TCHC_044 G09908 293 2 Burkholderia (2)
ND MPVQPSATPPPPPPPVIAVPPPPPPLGGVLPPPPPPSTGGPPMPPPPTGASGASAGPGIAFRPISLSPVLNDNMRHSPAW
RVGDYVNLETLRITISTTLDVAPRDIDITETTMRGLADAMGTRYEDELTLNPIAWTSPAGKIYMATDAPEYSASGVLDEQ
KIRSTIVHESLHAASHNHTGYQALTKRSGMNANWNYDEFATDYFAREVYEQIYPGATYKTNYFTKDLGGKAKVWGGNLIE
FMLQSGHMTRENIIASFARGSVAFDELSGDKLEAWKRYAKTGDPKKLSPYLRA
TCHC_045 G01888 292 4 Pseudomonas (4)
ND VTTPPQTRRASQTSITIPTPGSSRRSSSASVPTLVTDPQANPPGRLPPDPELTWSERAKAAALSFANSRVGLTLVPVGGM
SMTSAAIISPILTLSVRLALNAIMFNPGWSPANTWDPDGDGELPPVDVTQAANRTYTMVTDGITGAATIASMILGPVLGG
LIDDWRGTVLQAENDQRGGVLMDAAEQRINDYQLVADPTKKALDALRAQVVEAEELAGVTWRSMGMLEKIDLMRPPPVAA
VAAVTPTNSPGSSRRGSTSSGRSSTSSGSTHSSVRRRNNLAPKRSSSKPTWV
TCHC_046 G01975 292 18 Pseudomonas (18)
Gly_transf_sug superfamily
(E-value: 4.0557e-06)
VAIPLNAHFYWEGGDIPIPHLQNMLLFKEINPDYQVNVWTSKVKHLLNPLAEMSESNDPAERHLALAHGDSLIQRNPEEL
FSSLGQAYPNAKKIEAIYSRETNGPYKNYAAASDIIELASTYMEGGLYMDADVAVGQPLGSLD
APNGFLVHIEDNLTSNA
VLASEPRGKMAGEIMDTIVDLYTTSPSMMENNENYGWKTKRSTPGEGLFSRLKLTMHMTGPWLIRSFLPATAEENKAYAV
PHDKFFYRETPRTDNMQPEQRSLSNIFFRGFKRGLNGEGRWTNVRPGRRASI
TCHC_047 G01881 291 7 Pseudomonas (7)
ND MIRPASPTPSQFSIPMSSAPSSPPHSVAGSMVNLSDLSEPVLNPGENPPGKMPPEPDESWSQQAKRLALAAVNSRVGVAL
LPIGTSSPANAAIVSTIVTAAAQLTVNATVFNPGWSLPGTWDPEGDGSIPPRDVTQGFNRHFAMLNTGVTLAAAVVGAAL
GPVLGGYVDEWRGTKEKAANKALAGEMSTTINRLIAEQSLLDVVTLKAQTALRDQVLEVETLIGITWNTMNMLEKITQLR
PARDSGSTVSSRRSSVVSQDSGSVRQRPSINRTLMRSTSNSSFSSARSFEV
TCHC_048 G09608 291 7 Pseudomonas (7)
COG5023 superfamily
(E-value: 0.015353)
SPFNFSEVLNKSKEQGDPVQARGLADITRFNPVFGGTLAVALSSSQKSLAFARQKTNQILSPFADLQERETVLGHFRIPA
EANPDTDSKILYMLSSSIGKLTSFIQQYDGTKIVGVGGSRNSKAVAWQYPEDAEHHLFIRDSVVHEHPHMVAWNIIHEAS
HMHLLTQDSWYMNVPGTTDEGTSGAQSYSGRLDILATVQRLQKRYEGFVWDGPDAVDVNRSAFEENPLARAQAILNNADS
ISLLVSVINQQFNGPMARLTARNA
SPSAISALDLASHAEQKHATQRRFSIG
TCHC_049 G09640 291 3 Pseudomonas (3)
ND VSTPYQDAYDAYDLMFKQGRVWEGLSQGAESGIETMARVSKRNLSTLSSEIDSEQHRQVVDRIAGIAPKDYWLVHFGRQD
FSTQEGIHFKTLVTLQKERGDLLYEGNSMGGNIPNYGNHDFSFFSLETGGSEPAKTRSRFGDIRFHTTLSALGDKFSYTH
MEATDLLRHNTREISPERAKSLKYLETIDTDEGFHDFKHRVGLREDKESDLLFYGEDMLPGLGHKIAADLSGLPTPLQET
VVEWTHGDRPLENVSQVINSFYRPQIAVPGGLMLKKGQYSSRKPDHYPGSI
TCHC_050 G19147 291 1 Pseudomonas (1)
YwqJ-deaminase superfamily
(E-value: 1.40804e-11)
ARGRLDYLDLASAPSPLSVRQAALSSDTSLADDFDSFNTATANMMQRAAAFREATQGTSGQEKKNIIAREGLKNEDNPDL
LPPKVAHAGYTSLKHELAENLFFNVQAKPTKFPGLRFVQGMSANETATRKTIRQTMPIPGFNGAKELPVTLESIIDHIEV
TDLDAMVTGVKKLYGQTKTTMHPFTEQRLRSHIQDSNFRLPAHAGVPGTHAEVLAQNSLLHRLDAQGSSISAGLRDTAMY
TVRVEAPNPEFPSCDHCSGIVS
PLIYMLTDRTQANRMAQLPIAPLRRRRSI
TCHC_051 G06210 290 12 Pseudomonas (12)
ND MKYEIAPFSTAATADAPLSTQIVTAHNTFNSRFITNTQDINNYVLAYDLTWTTRGLLYMGAGNQIGDILNSREHSWGLTH
QLRTNIGAYPSTQVRAEHAVAAGAGMCDEFAAVSSRLAASSLRGYGTPIHIAQIPGHTFTLLGDPTRDPLVVDPWVSYPI
PDRLSLSRYNHPQLQAFNTTPAMPQDPAYAISLANVATHTPLYTGVRPSMQPPLHQNIQNDLNSPAGVSSWVWDQMSSQQ
QSSDIWAFSNSTLLNFAHVPVNHRSRLDATALRPSIYAVQFQQPNPFRRI
TCHC_052 G09973 290 1 Burkholderia (1)
ND SPSFSSLVDQGVRYTEHKNGRRRWLLGEGRLMLHTGAANPASHLVIDAHGRFKGDTKEKDIPITREKKIHFFSPHYTRLR
LGIAASLDPEKVGAIVTSEGGAVVAQKYLDNINSALEIANGGRSGLRQVNINTLISGSSASGNIANYSLKGFYPTEDRYQ
NISDELEKSGGRHDYLTFTSETDDMLIGDVFKILEKHNLTYTSFYMSFCRECDFHSPTTVRNSGLELDYLAAHNKPIERN
LPACDGTALNSDSAKKSSSQSSTAPILSLSPDEQLEAVIKRMSKPGHVMI
TCHC_053 G00806 289 8 Yersinia (8)
ND MPVRKRSGGFSLLNNIEKHKNVRDSDVTNLGLHNIEYNALRSLAKEKGWDINVRTGNQARVQYVGLKGYRPKPAGVYQKT
NKEGDYQGLVLYKEHEYQKGLIDVEHINNPAKNAMDSIKVLGQEGFHLQKSVIGGNTYYLLVDKFENKVYGDIDLHSVLD
KNGREVSPDEWVTALNTTLEKTKLHGKELMHGDNKLIKTYNVLSHSPIQHGAHDEWQDRNDKSYAGGINMGPQPGVIDIS
PKGSKLLETTTHYNDYLRQRSIVGDKVYTSSAWKAGANRKLSETYKRIS
TCHC_054 G01864 289 17 Pseudomonas (17)
ND NLEESAARQQITEYSNLLSQVNSEVKKLNYQLYNLTRTRDIYKTGAKKLAFSVVTFAVTIKAGAFGAVIGGGAASVTGPA
APVLMPVAAAVGGIFAADAANKVMEKLGNETTLGYTIMPDPSALSVSRLKSKASATPFSVKSVVNSFNPQTSDGLTKTVI
ETTARTMGKHLKVSYLKQGLAIARQSAQLTEALNDSWGQGDLDQISAKLDELTTFLDSEESKALMSFEILTDAAPASEQL
VGAAHMPMPSDNDLPTLQQQMKVARSAIKQSRSLLGRVSQYLVEKRHAA
TCHC_055 G01954 289 35 Pseudomonas (35)
YwqJ-deaminase superfamily
(E-value: 2.3301e-05)
NKDSKTLQGGNELLTLMSERTQLILQGGANPLPAITGSPAKVKKMREIHFSDNPEAELFLKKNRDDNLVAHAGFEIPGAT
PDETIRLTDFFNIPLPPQLTVERHGVVEYRPAEQGLERDDPVSGGIFKFGDIDRYETFLEKKLIETYQDTQRPIKVYKGT
NPDPINLAGLEYETPTFQPLLQRRMKAHIVAGGSYLPKSAGLPGMHAESVGGHVALAFQKAMTGEADPSQILVVTQKLKG
AKTASAFPACFNCANIL
MESQDGSAPFNVLTDRVNMTHQQWNRALQPYI
TCHC_056 G08104 289 46 Pseudomonas (46)
Gly_transf_sug superfamily
(E-value: 0.0011683)
VRTAINKDIHLIWVGEDANKLKPLTDNINNTATQADGYKVHLYLDSAKEDNFSNIVEELKIHDFIPLRGSELFNDFQNSQ
TATIYNDFRSGSPLNFAHAVDVLRMFIVEKKGGIYSDVDDYYFHDDTDMHLRLGDRSIGAEPDELRTLPPVSVPWEAAST
HPGVYINNSSFAAHPGNTVLKEISKEMVARYNKIFDLKQYNDDNDFIGEGILHQEPVGRFKIMSSMVGPGLLTDVYKRID
NEIGPAIENIVASFSGKEFDQHTIEKTNRKLALGRFIRSGDLASWRRPL
TCHC_057 G00111 288 182 Salmonella (167)
Yersinia (14)
Cedecea (1)
ND APTASGGAEKPKLSDKQSQKVDAVYKKMGTGKLWCAKNPQFSCLYAPSSAARVRQISSDNIRALKKRLGKMSPEEKTFVE
RFMQLEFQMIHHTNAHITNPKTLEETFLSRDELINRRIVFDTTHTTDADVVQLANTGFAFFALSVKGIKLQKSNSRFGKN
VHVVSMDTAKQKSPYMTEAHMVINNTLKFKERKLSERLVTLLGGDDIARRDARVFSHQVVADDAKDTLFHIDDIHMGLAL
SILWSIRSAPISERSRQILLGVKGEAQFEQLITTLFRPQILVPVELTV
TCHC_058 G01886 288 1 Pseudomonas (1)
ND LHKGANDQNEEIAIESKYDYAVKYRGNTEALAAGEIEFSKTNDAAWKLSAKLIKDTIKYLESANPDGLDSFLGGSRNAKL
DSGLTVAQSMLRSYKAIHKAIPRYQRGGDLRDQIVYLESRADVLLEDNAFVITDDAHRRIFVTELFRSNNVIGRARILIH
ELSHLVSDTEDPFGYPKSFFHYGTSESETASRLQDLPIHISEIHTELREKNPSPGESEQLLASNADTLALFSLLMLRDKD
MVKGLARSVDPHIEGARKSTSGNRLVNFLGSLMPGKNRWPSLANRPEQ
TCHC_059 G01919 288 10 Pseudomonas (10)
Amidase superfamily
(E-value: 0.0111898)
DKEDVNLKQEIAVYPNILSAINNRVSTLNYQLYNSMRTKDITKRVFQAYGYNAFKNLASLGAGALAAPAGLVGSWAAMSG
IAVGIDTLAGKVDATRHLPASVYPQVSRLDPEEIEHEGRTAFYDLNAKSRKAIKDLDPRNTTGQKKLSLMMTSFILTKVL
RIPGAWIANFEASTQATKTSNGIPGQKIQRLDNALLELDKHLEHDAKAIDAAFDTLGVEEFYTHGAKGLLDRTLDRMSNT
TGTASARTVRRTEIQQQIR
VTRANIQHGRELLFRLNQYNQSRGRYAIV
TCHC_060 G12116 288 19 Pseudomonas (19)
ND SAEIPELIAGAAVVGAVLIGALGFYFSRRNNQAQSAPPLSPSSLLQQTFNLSEAERQKVRNFNYNKGLVSDPSLTDIKGF
SDGSKHAYAPKNPDHAKILKGSNSSSLSSQIKSGSINSVMLQAANAQPEVPRRATTVPQSFGFEVFAPRFLSRQKTANIA
APVDPGQAQAQAPIAVPYTVDVEGFKETNNYMALTKEQKTKVHNVIDEWLAREDISSYSYHKYKGEVKDPIFGMQKVYTI
DLKGYDDTGGGRGDWRLVMYKIDGVYNPQRVSRHRDIDARIKSKSGFS

*Experimentally confirmed functions are highlighted with link to related references. Domains are identified by the Conserved Domain Database of NCBI using representative sequence. '' and '' indicate incomplete match in N and C ternimal of the domain, respectively.

Page  1  2  3  4  5  6  7  8  9 
2019-2022 IPB, CAMS&PUMC