Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

List of TcC hypervariable region (HVR) clusters: 171


HVR cluster Represent Length (AA) ↓ Number of TcC Related genus
(number)
Function / domains* Representative HVR sequence (with domain region underlined)
TCHC_001 G05780 527 1 Achromobacter (1)
ND MAKKEDTEQREQAAASSAAADRPSTSTNTSLLTVDTSVAQDISGPEFASPSKVFSELTVQSEGDAGRIARKRFSNLSDDT
DGPSAKRARQDAIDSRNTIMKYLKENPGIGFARLENDRLVYHSESPEFEAAARSLLGSRNSAGSIADAQDTKDIRQVRVM
EICQAQGALVVALQRETSAHLKQLDADFAPTASLMKSLEDELKPLLKGKNAQNINAKRIGEINEKLKPLFPKRADNERER
NRVLNEMSLIGNILSSTHNKRTAINNERQRASFAINLAGVFKTAASAQKSKGFAFATFGTQKAFWFLGSAVNIKMNPKEF
KTYAPKKASSGIAGDKKLYFNKFEPSELPAHFEELDKHLVENNYSKLHAYTKHRIAGFNAKETQASDLQGEAYIGERQHI
NRAGVPGTHAESILFNELLHAFYPESQNTDFDTIESEMGAGLLNNLKIYTFYLIDPQEGGYHLFEACQGCSAIIGDGINA
INGKGTLAYNKVAEMIEEMRSMGIADNPDAISEHLISMKVPYQINFR
TCHC_002 G00329 425 3 Burkholderia (2)
Paraburkholderia (1)
ND KASNWQLFKTMAKKHGPKLVPWVTPILAAGAVALGVPGVVIGAVAATAGLIYSGYQGYKAFQRFRRGDGSGDATRRSQEA
VIATASPKQLSFLGKVGRALRWGGAAAAVAGGIAAAVGAAPLVVAGVGIAAALGGAAFAVGAASRLARRHAAHQARQIQR
EGGGIVSYGARSAATTFVSAEMHGASHTGAAVAMAGTAPISMLGWAEQNAEASVAGAHAGGVAVGEYESISRAVGVETAT
DIPALVGTALGGGAMGYLHGQLEGATEVGQAAGAMARQTRARLWLGFDAVNAYTRSLGESMFDTGVSLVRDVAHYMGFTG
GRSWAGRAVQFGSRMAGWLLGNRIRAAAGYTIGSAVLGAVGVGALPASTGAITFAAAAGGAAYGGYHALPEGGFISGMRR
IATGVINRATTHWLAFPNLGTSSTA
TCHC_003 G02970 373 9 Xenorhabdus (5)
Mycoavidus (1)
Enterobacter (1)
Candidatus Endobugula (1)
PRK12688 superfamily
(E-value: 0.013151)
ASLMSNVITLIGGIFNNGFSLPSFSRPSFSWPSFSLPSFSRPSFSFDFDFSFDFSPVGVVKKIAGPAIKFVYKKAYKKLL
NYALSKAKTEQQKRNIIRGFRGVSVGVGVAVAIAGVVSSAGLAIPVAVGVVAAGGAIAGAVGVFAGPISRSLSKAYAKLF
RGRTAAHLSTATGNFMAGGSAGSAAVAHGVTSVNDPVLKRQGRTGEYRSLAGAEVGIASGTVSAVLNDDLVKSGIAASAA
AMGSQVSESQKALEGVGDVAATAAIEGASAGRKLAKALGLRSLTARAAETVAEVATNVDISPASLIENSSTAIYAHGKTF
LHVRTGDTNNFEAFRNIEETLPADGDAGWLSGA
LENVWGWFSWSRNQNQESFA
TCHC_004 G05075 369 1 Enhygromyxa (1)
PLN02720 superfamily
(E-value: 0.0412001)
SPHQLGDNISVDQVEDWKSDSSLIAPGATPVLIAGTDDRYLVIPTESIFARPGERAEEGHFAWAFTPSFAGQAWGKKYAH
AVQEIADNRETAAAAQQILASNKMIAAFGLGGGATVAGGLSGGLALKLGLPLIGTALGSSILGGATTGWTLEGGLALLDG
QSPGEALARANRGGLVGGALGGAGYFAGRGIGWGLSKLRGGAPSTTQTAFQQGMPLIRAVRPAPSTLPPGGSSAAGEIDA
AVGAEVEVTVDAAELHGLFYHQVNKGGLDEIVESQILRVSEANSRGYGEAIRAYPGEATGTGGQGVVKFYTYEAPHYVKP
ILNPGWGGNATKPLAEVRWTNVESIGIRLRRVFYPDGRAIWFLKPPPPP
TCHC_005 G00957 366 57 Photorhabdus (32)
Yersinia (17)
Xenorhabdus (8)
ND ASKKRGQNVFLFATALFRRKGEGLTQSMDRAIKITRGVFIGLSLMTTMISICVFAGAAVGVTLGVAAIGFAIGALLGYKV
GYFLKKIGGALAKLIQGKSTPIQMAACSGMAALTAQAQGATLRGTAVASITGMATGGIGAALDNAERGVGGAMGAGTAVG
VVDTLAGNSANLTSQVSGAIGGAIGGMMTGTDKALRVGRHAGYGATAGSWVGWGADLAYNAPNRLLRAGVAVAAAPAIEH
VAKEATSYFISGKKGEIAGSLAGYAMNKKAISLASGLISTAIEQPRFELAGAIIGAVIGGVGSAIVQTQGDSTWLGRAVG
WAGEQLNTAGALALDAYRGTILWYSGIANAKDFGVSAATGLHKIIA
TCHC_006 G05074 364 1 Enhygromyxa (1)
ND NEDEPTIWVPETDAPVEITVQTQPLSPADIVGHLFPGSGDTTPAERSWRDRLGYHLGVAIELRERAVDATVEALEAGKEL
YDNADDAGLAVGTLANELQSAISTESGRLQIGASLAEGFLSSIDKGIVAIDDYQEAAAKGDVEAGADAAIDVGEGALSLS
IVANPAAATARLTTRATNATVRAARTRRAVAQATRGESVAGGAAAERAAVRTAGREAAASRGAAASAAGGAVSPVRPAVT
NAGHAYAKALYPGGSGRAFAGHGELRLGAGNVTVPEGTSLTFYSKHGKSLTDRAGRRVERGSRFGLRRYKFFPGDRVPNY
TLKPPDGLKIRQNSITVATPTPLSDLLVPNMGDLDWAACRVTRL
TCHC_007 G05681 355 1 Runella (1)
PTZ00449 superfamily
(E-value: 7.01159e-06)
QSQPVPGLITNDAAIGAVWEQAVVNILGSRFNTGNYADTVRAFQSEVTRRITSHGGSLGSNRASGTAIHYARRSYASVRT
EFGRLLAQRGISLSGIQIHHTFSELARAPREALTTTNLMFARGNAGTVGSGHHFAHQVGEARAAGVSNPGQHVADRLASQ
GVTPDVPELSHASSTPHASSTPHTPSTPHTPHTPSAPHMPSAPHIPSAPHVPRAIHGRGVLFSIVVAGGVFLYTGSAYAA
AQSANPAAETTDAVVQGRGAGDVAGSVLLDVFYLTPQGAIIGLGVGLNRAAMDASHFPVPPGWIEQRVAEGRNPFCALCH
GPGNLRERESTVPSFTPREFTEADRQRMRQFIAPR
TCHC_008 G05740 342 1 Nitrosomonas (1)
SseC superfamily
(E-value: 0.0024234)
Peptidase_C80 superfamily
(E-value: 9.62903e-05)
LTTTPVTNDDPAILVGRIEATENEGARHATARAISSGFIGIDSNEQSIIENELPAGFGTYSDTGKEALLREGDIVTAELP
QSKIDEYEARFDAKLKYRAERILPDFIEGSGSVELSTIAGKVLESVAIGLKVLELGLTAVSVVGLAKGAVKLAAEKALAK
GAEKGLIAAETKAVSSFANLAGGNAAGSVAGQVTGKTSELAVVEAQTGNSVVTRSAQSLANARGEQLVSLGNLNSIQAGE
RLSLVAHGNRLSLGGMNSSQLSSTINASGVRPRSIELVACQTGC
GTFPAELASGTGAVVRAPLGNVNVLRGIPGSPQVRL
PGTDTLLPPGRGFRVHLPVVRF
TCHC_009 G05778 338 1 Achromobacter (1)
ZnMc superfamily
(E-value: 0.000430687)
TKKGSDGEEADRPEEIFGWEDGKSSPPSGLSLIPNIKDPENLSDDADGPSISLSRYSGVVTSNHYYGKHKEATFNATRYF
DGKITFGFEKTKDKFLQERTPALVTIKFKDIKIKTDIVPPTHAAFAYWADYAKNSGLKFEYEPDFSQSRVLLKIQEFKEK
NVLASTSTSHFLYPGMRPVIKVNKKFDYSKSDFSDAIKAMDPMLHSVEQPLQRNMLKSQAKRLGDLLVFRSIVHEIGHVL
GFSHPFDVNAEHAKKRVEKIYKNKANQVVLTTGTVSCGSVNYDFRSYATDGCPIMGY
TNMNLEYSAKLAIQLGEPLGYKH
IQPSQAEVDTLRRNLRRT
TCHC_010 G06511 338 20 Xenorhabdus (15)
Moritella (3)
Enterovibrio (2)
ND FSIANTLVHKGLKKADKYIDNKITHYLEKKGCKTSTILKVNKVRRTIFMGIGLGSLIGGIASGFGAGLGVAIGVGAIGFA
IGASVGWFANKLSNKFAGAMAEKVQGSSDTVQMAAGGTVAAASATLHNASARGTVIATGGGVVSGYVGAKLDDAKRGMGG
ANAAGAAVGYVDNKTAGGKARIPVEVGAVAGGVVGGLMVGTDYDTAAIGEWAGYGAMKGGDYGRQIDKAITKAAISVSVD
VSSYCLNLPELPIPEKLRDGAENFAANYLLKDGGAFEWAGAAAGGVAAGSYKAADEYTEGEVTRINESGQEATSTVSWEK
LSNAFWNYFGSGMEASEA
TCHC_011 G05069 337 1 Enhygromyxa (1)
ND SEVEAWVNTAVASTAQAAIRAAVKSGASARGLAKVSSSAANRIAHQSYSNDDGGGGDPDTGHEGSGEGDDVISDSPSVVR
KKTIGEYEAEAYRAWEQQFDAADSTYYDRPLIIDFIPLIGVRDFQHDTRQLGDAIWMGDGERAANAAAHVGIDVVMSVVD
VATLGADRLALGAFKMWSRAPRGTLGLAAHGGNGEMRNELKAAARDTGPLSTTDEGRMLHRGMREATGTPEAGPSARSLG
VRPDIDLPVVDGMVKPNTGGMSVAPDAPTNLPRHRRPPELGGTGKDPVFSINEKSLGPDLNFRQDKGSHGIIEPAREMKI
EEFQQALARIKALWTKL
TCHC_012 G00604 330 71 Pseudomonas (71)
ND TATPALEQPRQTQLRRLSISRRLAHMARIARPRMQAGASAAIRDGLSTYIANAISTGVDLAVFSNIQPTAQRNQILRLTV
AVLDAVSTAHMSTGVAGNWTRFAPQIGALFAGAAGVGYTVYGDSIGDQAEHSWDPVAVRRLGGHVRALSRELVQQVLRGH
GTGVSWGSTPLRGRVTRTAGATAAYGLATVANAVYGGEVPALMLPNVTPAIEAYDAAMGKMIRGGHPTATHDSHGQTLQL
PDPVATAHGGLSRMFNQVWTHWAASGVEALAVALTGSPVASQGRVTRNIVMVARGMISALTEWRGFFVQFARRGYSTLEA
GWRRGPRPTK
TCHC_013 G05663 330 1 Unknown bacterium ND EGYVPPVAQPKLEDPTRNQHRRLSNAYTNDQSKWHELGSVWFHKQSKLWIEKDDVEGLRELFSELYYIKYTGEDRVIKGQ
ATYGFDNARFSNDWFQRNLGMTSNEVASLPVSSQREIFSQNKEKYALDRSVAMANAGTILELYDEPLYKGQILEYKKRQF
NNNLNGSIERAEIKRRDELDMARSEALSGIFFGTATMVLLAANPTTLPRAGMTAGNITKSVVKYLSLAYSADSLAGDINK
LIAVEQGTYSSEAIYAPIELLSYEIAGDQGVLIYKIGKDTISFISDVYKLNDVRNFFTSAEQVSDKEIIKVIGWLSKDVP
KKTLNAAMQE
TCHC_014 G18551 325 14 Pseudomonas (12)
Rahnella (2)
ND VGMDANRAATVLQSRIKRFISPISVKTLTEGVISVSIKGDNAVFAKVGIELDREAAAPREFTYLSLSSSLRGKVSGGDAA
IPLSRAAGAQIADASGSMPAAYVNGGYFNMGARQAMSGPLPLPSPQLQNLEYASVGGNVIDSLQKPFIDPPDDYSSAYSK
LQLGDGSFIHVAPKLTTGGVMQFSRRDSLKTKHIYGEETGHVGALGHASDPNARSAISLAENNTARTRLAIALNQGRGTF
SRKTDEPGFTMLEWATVMARLDNLNPINERGPPAASSWNLDGGDSSTLGVLDPSGTHLLQVHTLKYGRSGVKSARPIGNF
LTFHR
TCHC_015 G03926 324 1 Candidatus Endobugula (1)
ND TGKRKNPAQSGPVLKKHKFAHTAFIAGQPLQKGTATGPKYHKFSSMSTADFTTYATDTGLVDTGVTQTWGTVSGKLMRSR
RGSVSGSYVEGGSPPNPPQVHSWRMHSLATSEALNSGSVDETSFVAVYNTSAGMLQNTTKNSNDKDMPTNLVLSDLGQVS
FDTTTSAFSFDDASYAQGSSGVGLKATQADKQFLYAPSIQNATAAGKAARPEQTYHSEAAAITLHAEARSTTAVNLQSKQ
NMLFMLASFPNQVCKQCGDTLGASLGAGSYVSGQPGVEFGHQKAGQFTGASATTLKAVPTATLMNSTNITTNENELKKIY
SYHK
TCHC_016 G13699 324 82 Pseudomonas (82)
ND ELWDFMDSFLETGQQRSTRKSRSAADQQQYRANMALSRALGRHTKILDLTTRRAREAETQINNHQSALAHGQSAALRIGT
HVAAQAISYGAGIGIGATAAALGSVAGPPGIAVGASLGVVAKKAVSMGLDYALERTSLSASVKFKSGKLDPNRIINKGDY
KAMNYGSYAYNKFKGIGLGIVQMNRKGWLKGGKEALNVGASIGMKAANTPFSSEIGAALSTVTGTFEILHEIAGAGQELT
DEKLTRADQHISGMIAILDEAVGVLDSLFEAAGRDAIHTYRPLGKVFGNAAGDTRETVITATNATITQLRQTQSVIRRAR
QGGT
TCHC_017 G18138 322 76 Pseudomonas (76)
ND AKAESVITLYAGFLSILGDVTARTRGQLHDVYRQKNIKRNLLMNAVNVVAFGTLGYEAGNIGGTQVGHLIPDASHATRVG
RMSRLPYIEAATGGNFGGDIAGSMTDAVSGLGGALADNAQLFGGRAANFSENMGRVGPLIPQTSAMSVAAIDSALGIPDA
ANEIQPNWNSIKDELIDPALNSILNPDFAVGRALGAWISILPGALNLFQRAVEAEDIKNRLDPVKIAKIEGMFADWESTT
LQRSAWMEAAFDSLGTNVVHLDPGPNGARAPITRAGLQQATTETLHSIRHLKGGLAAYKEAGSTDNQFLAKQRTAAAKAS
RR
TCHC_018 G00045 320 16 Pseudomonas (16)
ND AKVKWPTVADINAGVDRIIASQNASYSKNRQAIATRHMKDQMSQQVTRHIEILGLTKERASDAAKQLDRMGSGLDVALAA
TRRTLTLIIGKGISYGVGVGVGIGAQALGAVAPGVGNVVGAGLGIGAKIAVSGLIDYVAERTGMSAPVNLKTSKLTAKKI
IQKAEYKQMEPFEYLKAKYQNMKPDSQKSQLKFSKEAATQASGYILKSALTSMPSEAVSAIGTGVAVLLGLPEIVDETMG
ALSDKSGAKMLEFERQILGLVDEIESSNATIHRFANALSTTSIGGIDLDDLDRQTRHTTDMLHGLADTVRHHRASQKAAA
TCHC_019 G04834 318 12 Pseudomonas (4)
Yersinia (3)
Photorhabdus (2)
Paraburkholderia (1)
Pantoea (1)
Xenorhabdus (1)
YwqJ-deaminase superfamily
(E-value: 5.43022e-15)
APLEWLNLAPKKSSSDVTAAIYSNRNTEYGLPANVGAYYGKFNAKTQGILQITANNESELDNIKQEVISKYSKASSADAE
KKAQTAHSKAADKMKFTRSKLKKYAAHAGYAVINNSTNEESGQGSEGAPTYRDSFLNLEGSLEKKKTFPGVTLINENIKS
GFEEYSPDKLKKLTGPRRWKPEASLGYYVVTNIESFISGIRKQYSTKDYPLHPVVENRIREHVSGNNGILPKMAGIAGLH
AEVQALNAILSSSKDGAYSHSLSHSYIFTQRLVGAGQENPAGADFPACFNCSGILSGL
EHVMTGRVEHHSRLRRRKSF
TCHC_020 G09914 314 141 Burkholderia (140)
Pseudomonas (1)
ND VSEEELPLLEFPTRSARRSVSDMASGAWSGIQSALVSDTRAEQYRYTRFENSVYQGTTEPIEVRPSGPSGSSRPSRLAGA
LRERFAAIRASFVRRPRERALETVPLLDLRPEVSSGPIYTGRRTVSGSQARPRSSGYQRFGASSESSFTNLAEEAARLLN
PPPPASGGQGEGIETTPVSRANARSWEEMLSRARQNRAQRPPEFNQADFALDVGDINVVLQETDALNEAEAEALSQLTGE
SPTSFEESALETTPLIPETQAGSRARSSAESVSSFVAFAWWSAAFFSFAFAFSFFAFAWAISSRRARVGGVAWG

*Experimentally confirmed functions are highlighted with link to related references. Domains are identified by the Conserved Domain Database of NCBI using representative sequence. '' and '' indicate incomplete match in N and C ternimal of the domain, respectively.

Page  1  2  3  4  5  6  7  8  9 
2019-2022 IPB, CAMS&PUMC