Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

NCTC12028_00868


Source  Morganella morganii strain NCTC12028 genome assembly, chromosome: 1.
Protein accession  SQL17167.1
TC component  Orphan C (Show TC locus within this genome)
Gene  wapA_1
Start  935535
End  938333
Strand  +
Product  Cell wall-associated polypeptide CWBP200
Protein
(HVR is highlighted in red)
MSKTENTLHKKTPSVTVLSNRGQVVRDIVYHRHPDTPEKTDERITYHQFDKRGFLEKSADPRMQASGLSNFRYVTSLSGQ
VLCTESADAGISLTLNDAAGRLMISISQICTDKGQDNCSKAVTQTFRYEGADSAGRLLSITEQTAGQNAQVTERFMYAGN
SEAEKAKNLAGICTHHYDPAGLMQTDSIALTGVPLSITRQLLKDADKPVSWPESNPQTLLSAEKYTTQTIADATGAVLNT
TDAAGHQQKVTYDIAGLLRTSRVTVKGGTEKIIIKSVTYSAAGQKLCEEHGNGVVTTYTYEPQTQRLIAVKTEHPARKKI
FQDLRYEYDPVGNVLCVTNSAEETRFWHNQKVVPENRYTYDTLYQLVSATGREMANAGQQRSSLPDISPFDKASYTNYTR
NYIYDRAGNMTQIRHSAPATNNNYTTDITVSQRSNRAVLKTLADTPEKAEALFTPGGQQTQLQPGQTLSWTARGELQQVT
PVVRNGAAGDRESYRYDAGSQRILKTTVQKTGNSSLTQQVIYLPGLELYRGKENYQVICAGVAGRAQVRLLHWQDGKKDH
QRFSYDNLIGSSGLETDGDGNLLSQEEYYPFGGTAVLVAGTDSGIDYKTHRYSGKERDATGLYYYGYRYYQPWAGRWLSS
DPAGTVDGLNLFRMVRNNPVTLRDDDGRKPISENFSEEKGDMVYGLAGFRGKYISSALGRPFLPDSKDAPASIIDLYNNT
VSGQVLMSVDMKILQNFMKSPDKYEKKLSPPADIKDRVQKSRAYPLWDSYFSAGEKNEKFNIHSVYKEVRKNPGSTQYHE
WHMSGAQSVPKLLWKRGSKLGIEIAASGGGNKIHFALDNLNIKEIISKSGMGGQSITASELRYAYRNRERLGGNIHFYKD
DNEVDAPWVSNPEQWNTYKPKLLSVSGGQLVRRHTGFMGRLRASFSRTFRRN
DNA ATGAGCAAAACAGAAAACACGTTACATAAAAAAACACCGTCGGTGACGGTACTGAGCAACCGGGGGCAGGTCGTACGCGA
TATTGTGTATCACCGCCATCCGGATACCCCGGAGAAAACCGATGAGCGCATTACCTACCATCAGTTTGATAAACGAGGAT
TTTTAGAGAAGAGTGCTGATCCGCGTATGCAGGCATCCGGGCTGAGCAATTTCCGCTATGTCACCTCACTCTCCGGACAG
GTGCTGTGTACGGAAAGCGCGGATGCAGGAATATCGCTGACACTGAATGATGCGGCAGGGCGACTGATGATCAGCATCAG
TCAGATCTGCACGGATAAGGGGCAGGATAACTGCAGCAAGGCCGTGACTCAGACTTTCCGGTATGAAGGTGCGGATTCAG
CCGGGCGTCTGCTGAGTATCACTGAACAGACCGCCGGGCAGAACGCTCAGGTAACTGAACGTTTTATGTATGCAGGCAAC
AGTGAGGCGGAGAAAGCAAAAAACCTCGCGGGTATCTGTACACACCATTATGATCCGGCCGGGCTGATGCAGACGGACAG
CATTGCGCTGACCGGCGTGCCGTTATCCATAACCCGTCAGTTGCTGAAAGATGCGGATAAGCCGGTTAGCTGGCCGGAAA
GCAATCCGCAAACATTATTATCTGCTGAAAAATACACCACACAAACCATTGCAGATGCGACCGGTGCGGTGCTGAACACC
ACGGATGCGGCGGGTCATCAGCAAAAAGTGACTTATGATATCGCCGGATTACTGCGCACCAGCCGGGTGACGGTGAAAGG
CGGTACGGAGAAAATCATTATCAAATCTGTGACGTATTCCGCTGCCGGGCAGAAGCTGTGTGAGGAGCACGGTAACGGTG
TAGTGACCACTTACACTTATGAACCGCAGACCCAGCGCCTGATTGCTGTCAAAACCGAACATCCGGCACGGAAAAAAATA
TTTCAGGATCTGCGTTATGAATACGATCCGGTCGGCAATGTGCTGTGTGTGACCAATAGCGCCGAGGAGACGCGATTCTG
GCATAATCAGAAAGTGGTGCCGGAAAACCGATACACTTACGATACCCTGTATCAGCTGGTCAGCGCCACCGGGCGCGAGA
TGGCCAATGCCGGACAGCAACGCAGTTCCCTGCCGGATATTTCCCCGTTTGATAAAGCCAGTTACACCAATTACACCCGC
AACTATATCTATGATCGCGCCGGGAATATGACGCAGATCCGTCACTCAGCACCTGCTACCAATAATAACTACACCACGGA
TATCACTGTCAGTCAGCGCAGCAACCGCGCAGTACTGAAAACCCTGGCGGACACGCCGGAGAAAGCGGAAGCCCTGTTTA
CCCCGGGCGGACAACAGACACAGTTACAGCCGGGACAAACTCTGTCATGGACTGCGCGCGGCGAGCTGCAACAGGTTACG
CCGGTGGTGCGTAACGGTGCCGCCGGTGACCGCGAAAGCTACCGTTATGATGCGGGCAGCCAGCGTATTCTGAAAACCAC
CGTGCAGAAGACCGGTAACAGCTCACTGACACAGCAGGTCATCTATCTGCCGGGGCTGGAGCTGTACCGCGGAAAAGAAA
ACTATCAGGTGATCTGCGCCGGTGTTGCCGGGCGGGCACAGGTACGGCTGCTGCACTGGCAGGACGGCAAAAAAGATCAC
CAGCGGTTCAGTTATGACAATCTGATCGGCAGCAGCGGCCTGGAAACGGACGGCGACGGTAACCTGCTGAGTCAGGAGGA
ATATTATCCGTTCGGCGGCACAGCTGTGCTGGTGGCCGGTACGGACAGCGGCATTGACTACAAAACCCACCGTTATTCCG
GTAAAGAGCGGGATGCGACCGGGCTGTATTACTACGGCTACCGCTATTATCAGCCGTGGGCAGGGCGCTGGCTGAGTTCA
GATCCTGCGGGAACCGTTGACGGGCTGAATCTGTTCCGGATGGTGAGGAATAATCCGGTGACGTTAAGAGATGATGACGG
GCGGAAACCCATCAGTGAAAACTTCAGTGAAGAAAAAGGTGATATGGTTTATGGCCTTGCCGGTTTCAGAGGAAAATATA
TTTCTTCTGCACTGGGACGTCCGTTTTTACCTGACAGCAAAGACGCACCTGCATCGATAATTGATTTATATAATAATACG
GTATCCGGTCAGGTATTGATGAGCGTTGATATGAAAATATTACAGAATTTCATGAAATCACCGGATAAATATGAGAAAAA
GTTATCGCCACCGGCTGATATAAAGGACCGTGTACAGAAAAGCAGAGCATATCCTTTGTGGGACAGTTATTTTTCTGCTG
GTGAAAAAAATGAGAAATTTAATATACACTCTGTTTATAAAGAGGTCAGAAAAAATCCCGGAAGTACGCAATATCATGAA
TGGCATATGTCCGGGGCACAATCTGTACCGAAACTTCTCTGGAAAAGAGGTAGTAAGCTGGGGATAGAAATTGCGGCATC
CGGTGGCGGTAATAAAATCCACTTTGCTCTTGATAATTTAAATATAAAGGAAATTATCAGTAAGTCAGGAATGGGCGGAC
AGTCTATCACTGCCAGCGAATTGCGCTATGCTTACAGAAACAGAGAACGGCTTGGCGGAAATATACATTTTTACAAGGAT
GATAATGAGGTTGACGCTCCGTGGGTATCAAACCCTGAACAGTGGAACACGTATAAACCTAAATTATTATCGGTATCAGG
CGGACAATTAGTCCGGCGGCATACCGGATTTATGGGCCGTTTACGTGCATCATTCAGTCGTACTTTCAGGAGAAATTAA

2019-2022 IPB, CAMS&PUMC