Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

SAMN04490180_3436


Source  Pseudomonas brassicacearum strain BS3663 genome assembly, chromosome: I.
Protein accession  SDP86514.1
TC component  Orphan C (Show TC locus within this genome)
Start  3711393
End  3714110
Strand  -
Product  insecticidal toxin complex protein TccC
Protein
(HVR is highlighted in red)
MGMDYRTPTLIAVDSRSRPVRSVEYCRSLENGPAQRRINRSLFDLAGRAVKQWDPRLWAMQDRDELAPSNLSAIYSLSGV
TLRTDSVDAGRQTDLPGLAEEGLLGWDSRGTLRDVLYDESLRPVAVFEQGGGMPRRCTERMTYGYPGQGDQNQNQYGQLI
RHDDTTGTLLLASFALTGQNLMQDRRYILDAALPDWPEPEPDREQLLEPGSGAVSTWRVGPLSDELERVDARGNRQRQRL
TLDGRLSGSQLLLAGQGDWQTLVSDIRYDALGQIEGEIAGNGVKTTLIYSPEDGRLAERQALRSGQVQQHLRYVYDPMGN
VLSIEDAALAVRYFANQRIDPISRFVYDSLYQLIKATGWEAGSANQGPDSLRQNGPAAVSNYQQTYRYDEGGNLLTLVHV
GAQNHGRETQAARYSNRCLPYRNGVPPTEDEIAAAFDARGNCLELYAGRFLVWDSRNQLSSVTSIERDSGLDDSEVYAYD
GGGQRVRKLRTLQTGARSLAAEVRYLPGLELRADSSTGESLQVITAQGGLNSVRILHWESPPPAGANDLYRYSFADHLGS
TSLELGQDGRIISREHFYPFGETAYLAGADGVEASYKTVRYSGKERDATGFYYYGYRYYMPGLQRWLNPDPAGDIDGLNL
YAMVSNNPLTFRDADGLNKTGKYEIEMGVKNRLKLAGAALTSRVSVFKQATGKYSEVNDFKVVEVGAFNDYLVGGDEVRQ
NLQRYKQRYKTLSSETARSKVVGQPSNFGLGASISGYMLRSANDVFVDEPNDPDALHRHPDFVVERRFFAVMKKSDKLKS
PEERHIYGLAELNMFTSEGKTEVDVVQVVVHPETQGDGTLKKEALAEATSVARLPILKGVGTFLTVRAIKAISKGADIRK
IRTDAVNPRSARIAEKFDAKRVVNQ
DNA ATGGGCATGGATTATCGAACGCCGACGTTGATAGCCGTCGACTCGCGAAGCAGGCCGGTTCGTTCGGTCGAATACTGCCG
CAGCCTGGAGAACGGCCCGGCGCAGCGGCGTATCAACCGCAGCCTCTTTGACCTCGCCGGCCGCGCGGTGAAACAGTGGG
ATCCGCGGTTGTGGGCCATGCAGGACCGTGACGAATTGGCCCCCAGCAACCTTTCGGCGATTTATTCGTTGTCCGGCGTC
ACCCTGCGCACGGACAGCGTCGATGCCGGCCGGCAGACCGATCTGCCGGGGCTCGCCGAGGAAGGACTGCTGGGCTGGGA
CAGTCGAGGGACACTGCGCGATGTGCTCTATGACGAATCGCTTCGCCCCGTGGCGGTGTTCGAGCAAGGTGGTGGAATGC
CGCGTCGGTGTACCGAGCGCATGACCTACGGATATCCGGGCCAGGGCGATCAGAACCAAAATCAGTATGGCCAACTGATC
CGTCACGACGACACGACGGGTACGTTGTTACTGGCGTCGTTTGCCTTGACCGGGCAAAACCTCATGCAGGACCGCCGTTA
CATCCTCGATGCGGCTTTGCCCGATTGGCCGGAGCCGGAACCCGATCGCGAACAACTCCTTGAACCTGGAAGCGGTGCCG
TTTCGACGTGGCGCGTCGGCCCGCTGAGCGATGAGCTGGAGCGAGTCGACGCCCGGGGAAATCGCCAACGCCAACGCCTT
ACGCTCGATGGCCGGCTGTCCGGCAGCCAACTGCTATTGGCGGGGCAGGGCGATTGGCAGACGCTGGTGAGTGATATTCG
CTACGATGCCCTTGGACAGATCGAGGGAGAAATAGCCGGCAACGGCGTGAAAACCACCCTTATCTACAGCCCTGAGGACG
GGCGCCTGGCGGAGCGCCAAGCCCTGCGTTCCGGCCAGGTACAGCAACACTTGCGCTACGTTTATGACCCGATGGGCAAC
GTGTTGAGCATCGAGGACGCAGCCCTGGCGGTCCGCTACTTTGCCAACCAGCGCATCGACCCGATCAGCCGCTTTGTCTA
CGACAGTCTCTATCAACTGATCAAAGCCACCGGTTGGGAGGCGGGCTCTGCAAACCAGGGGCCCGACTCGCTGAGGCAGA
ACGGCCCGGCGGCGGTCAGCAATTACCAGCAGACCTACCGCTACGACGAAGGCGGCAATCTGTTGACGCTGGTTCACGTC
GGGGCACAAAACCATGGTCGGGAAACCCAAGCGGCTCGCTATAGCAATCGCTGCCTTCCGTACCGCAATGGTGTTCCGCC
CACGGAGGACGAAATCGCTGCGGCGTTCGATGCGCGGGGCAACTGCTTGGAACTGTACGCGGGACGGTTCCTGGTCTGGG
ACTCGCGCAACCAGTTGAGTTCGGTCACGTCCATTGAACGCGACTCGGGGCTTGACGACAGTGAAGTGTATGCCTACGAC
GGCGGTGGGCAACGTGTGCGCAAGCTGCGAACGCTGCAAACCGGCGCCCGTAGCTTGGCCGCCGAGGTGCGTTATTTGCC
GGGCCTGGAGCTGCGTGCCGACAGCAGCACCGGAGAGTCACTCCAGGTCATCACCGCCCAGGGTGGGCTCAACAGCGTCC
GGATATTGCACTGGGAAAGCCCACCACCTGCGGGGGCCAATGACCTCTATCGATACAGTTTTGCCGACCATTTGGGTTCG
ACCAGCCTGGAGCTTGGCCAGGACGGGCGAATCATCAGCCGGGAGCACTTCTATCCCTTCGGCGAGACCGCGTACCTGGC
GGGGGCTGACGGGGTCGAGGCCAGTTACAAGACGGTTCGTTATTCGGGGAAGGAAAGGGATGCGACGGGGTTCTATTACT
ACGGCTATCGCTACTACATGCCTGGCTTGCAGCGCTGGCTCAATCCAGACCCCGCGGGAGATATCGATGGGCTGAACCTC
TACGCGATGGTGAGCAATAACCCGCTGACTTTTCGGGACGCCGACGGGCTTAACAAGACTGGAAAGTACGAAATTGAAAT
GGGCGTGAAGAATCGACTCAAGCTCGCAGGGGCAGCGCTTACGAGCCGGGTTAGCGTGTTTAAGCAAGCCACGGGAAAGT
ACAGTGAAGTGAACGACTTCAAAGTAGTGGAGGTCGGTGCATTCAATGACTATCTGGTGGGAGGAGATGAGGTCAGACAG
AATCTTCAACGCTACAAGCAACGCTATAAAACCCTCTCCAGCGAAACAGCGCGTTCGAAGGTCGTTGGGCAGCCTTCAAA
CTTCGGTCTGGGGGCAAGCATTTCCGGTTATATGTTGCGCAGTGCCAATGACGTATTTGTGGACGAGCCGAACGATCCGG
ACGCTTTGCACAGACACCCTGACTTCGTCGTTGAGCGGCGCTTTTTCGCAGTCATGAAAAAATCCGACAAGTTGAAATCG
CCCGAGGAGCGGCACATTTATGGTCTGGCTGAACTGAACATGTTTACTTCCGAGGGAAAAACGGAAGTGGATGTTGTGCA
AGTGGTCGTCCATCCTGAAACCCAGGGTGACGGAACGTTGAAAAAAGAGGCGCTGGCAGAGGCCACCTCAGTGGCGCGAC
TGCCGATTCTGAAGGGAGTGGGTACATTCTTGACGGTGCGCGCAATCAAGGCGATTTCGAAGGGAGCGGATATCAGAAAA
ATCAGAACGGACGCTGTCAATCCGCGCTCTGCCAGGATTGCCGAAAAGTTTGATGCCAAGAGAGTGGTCAATCAATAA

2019-2022 IPB, CAMS&PUMC