Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

CSB69_0004


Source  Morganella morganii strain AR_0057 chromosome, complete genome.
Protein accession  AVK35158.1
TC component  Orphan C (Show TC locus within this genome)
Start  4343
End  7204
Strand  -
Product  RHS repeat-associated core domain protein
Protein
(HVR is highlighted in red)
MSKTENTLHKKTPSVTVLSNRGQVVRDIVYHRHPDTPEKTDERITCHQFDKRGFLEKSADPRMQASGLSNFRYVTSLSGQ
VLCTESADAGISLTLNDAAGRLMISISQICTDKGQDNCSKAVTQTFRYEGADSAGRLLSITEQTAGQNAQVTERFMYAGN
SEAEKAKNLAGICTHHYDPAGLMQTDSIALTGVPLSITRQLLKDADKPVSWPESNPQTLLSAEKYTTQTIADATGAVLNT
TDAAGHQQKVTYDIAGLLRTSRVTVKGGAEKIIIKSVTYSAAGQKLCEEHGNGVVTTYTYEPQTQRLIAVKTEHPARKKI
FQDLRYEYDPVGNVLCVTNSAEETRFWHNQKVVPENRYTYDTLYQLVSATGREMANAGQQRSSLPDISPFDKASYANYTR
NYIYDRAGNMTQIRHSAPKTGNNHTTDITVSQRSNRAVLKTLADTPEKAEALFTPGGQQTQLQPGQTLSWTARGELQQVT
PVVRNGAAGDRESYRYDAGSQRILKTTVQETGSRTQTQQVIYLPGLELYRGKENYQVICAGVAGRAQVRLLHWPDGKKDH
QRFSYDNLIGSSGLETDGDGNLLSQEEYYPFGGTAVLVVGADSGIDYKTHRYSGKERDATGLYYYGYRYYQPWAGRWLSS
DPAGTVDGLNLYSMVRNNPVSFSDEQGLVAYPRTQIPGTSLYQPGINTGSDREIRGAKLIPPAANTVTELFKGEPVRLDD
VLADSTLQQTPLLTDLINPAKVKMDSSTRSSLSAVKGGIMEFNAVHIPAGNNGINALRIIDTETSAFQRGKGTTLAYWVP
QGGYADIPAHPENGQPQLVFTPGFSGCSFVADKLDDTTIRVRHVQGGKEDAEYNRLHASEHGHGMIGAMEYRDYGYHENY
SGAVLENIQGSAFMKYEGDSWQIKYQRLKNAPGIVSMGEKTSGIVRKQQGLKLEIRHSRERSVVGTGSVPLMH
DNA ATGAGCAAAACAGAAAACACGTTACATAAAAAAACACCGTCGGTGACGGTACTGAGCAACCGGGGGCAGGTCGTACGCGA
TATTGTGTATCACCGCCATCCGGATACCCCGGAGAAAACCGATGAGCGCATTACCTGCCATCAGTTTGATAAACGAGGAT
TTTTAGAGAAGAGTGCTGATCCGCGTATGCAGGCATCCGGGCTGAGCAATTTCCGCTATGTCACCTCACTCTCCGGACAG
GTGCTGTGTACGGAAAGCGCGGATGCAGGAATATCGCTGACACTGAATGATGCGGCAGGGCGACTGATGATCAGCATCAG
TCAGATCTGTACGGATAAGGGGCAGGATAACTGCAGCAAGGCCGTGACTCAGACTTTCCGGTATGAAGGTGCGGATTCAG
CCGGGCGTCTGCTGAGTATCACTGAACAGACCGCCGGGCAGAACGCTCAGGTAACTGAACGTTTTATGTATGCAGGCAAC
AGTGAGGCGGAGAAAGCAAAAAACCTCGCGGGTATCTGTACACACCATTATGATCCGGCCGGGCTGATGCAGACGGACAG
CATTGCGCTGACCGGCGTGCCGTTATCCATAACCCGTCAGTTGCTGAAAGATGCGGATAAGCCGGTTAGCTGGCCGGAAA
GCAATCCGCAAACATTATTATCTGCTGAAAAATACACCACACAAACCATTGCAGATGCGACCGGTGCGGTGCTGAACACC
ACGGATGCGGCGGGTCATCAGCAAAAAGTGACTTATGATATCGCCGGATTACTGCGCACCAGCCGGGTGACGGTGAAAGG
CGGAGCGGAAAAAATCATTATCAAATCTGTGACGTATTCCGCTGCCGGGCAGAAGCTGTGTGAGGAGCACGGTAACGGTG
TAGTGACCACTTACACTTATGAACCGCAAACCCAGCGCCTGATTGCTGTCAAAACCGAACATCCGGCACGGAAAAAAATA
TTTCAGGATCTGCGTTATGAATACGATCCGGTCGGCAATGTGCTGTGTGTGACCAATAGCGCCGAGGAGACGCGATTCTG
GCATAATCAGAAAGTGGTGCCGGAAAACCGATACACTTACGACACCCTGTATCAGCTGGTCAGCGCCACCGGGCGCGAGA
TGGCCAATGCCGGACAGCAACGCAGTTCCCTGCCGGATATTTCCCCGTTTGATAAAGCCAGTTACGCCAATTACACCCGC
AACTATATCTATGATCGTGCCGGGAATATGACACAAATCCGTCATTCAGCACCGAAGACCGGCAATAACCACACCACGGA
TATCACCGTCAGCCAGCGCAGCAACCGCGCGGTACTGAAAACCCTGGCGGACACGCCGGAGAAAGCGGAAGCCCTGTTTA
CCCCGGGCGGACAACAGACACAGTTACAGCCGGGACAAACTCTGTCATGGACTGCGCGCGGCGAGCTGCAACAGGTTACG
CCGGTGGTGCGTAACGGTGCCGCCGGTGACCGCGAAAGCTACCGTTATGATGCGGGCAGCCAGCGTATCCTGAAAACCAC
CGTGCAGGAAACCGGTAGCAGAACACAGACACAGCAGGTCATCTATCTGCCGGGGCTGGAGCTGTACCGCGGAAAAGAAA
ACTATCAGGTGATCTGCGCCGGTGTCGCCGGGCGGGCACAGGTGCGGCTGCTGCACTGGCCGGACGGCAAAAAAGATCAC
CAGCGGTTCAGTTATGACAATCTGATCGGCAGCAGCGGCCTGGAAACGGACGGCGACGGTAACCTGCTGAGTCAGGAGGA
ATATTATCCGTTCGGCGGCACAGCTGTGCTGGTGGTCGGTGCGGACAGCGGCATTGACTACAAAACCCACCGTTATTCCG
GTAAAGAGCGGGATGCGACCGGGCTGTATTACTACGGCTACCGCTATTATCAGCCGTGGGCAGGGCGCTGGCTGAGTTCA
GACCCGGCAGGAACCGTTGACGGACTGAATCTGTATTCAATGGTGAGGAATAATCCGGTGTCATTTTCTGATGAACAGGG
GCTTGTTGCTTATCCGCGCACACAAATTCCCGGAACATCTCTTTATCAACCGGGTATCAATACAGGCAGTGACAGGGAAA
TTCGGGGCGCTAAGTTGATACCTCCGGCAGCGAACACGGTTACTGAATTATTTAAAGGAGAACCCGTCAGGCTGGATGAT
GTATTAGCTGACAGTACATTACAGCAAACACCTCTGCTTACTGACCTGATTAACCCGGCGAAGGTAAAAATGGACAGTTC
GACGCGAAGTTCTCTTTCTGCTGTTAAAGGCGGAATAATGGAATTTAATGCTGTTCATATACCGGCCGGAAATAACGGTA
TCAATGCATTACGGATTATTGATACCGAAACATCGGCTTTCCAGAGAGGGAAAGGAACAACATTAGCATATTGGGTTCCG
CAAGGAGGATATGCGGATATTCCTGCCCATCCTGAAAATGGTCAGCCTCAGTTGGTATTCACGCCGGGGTTCAGCGGGTG
CTCGTTTGTTGCTGATAAACTGGATGATACGACTATCAGGGTACGACATGTTCAGGGAGGTAAAGAAGATGCCGAGTATA
ACAGATTACATGCGTCTGAGCATGGGCATGGAATGATTGGAGCAATGGAATATCGCGACTACGGATATCATGAAAACTAC
AGCGGAGCAGTTCTGGAAAATATCCAGGGATCAGCATTTATGAAATATGAAGGAGACTCATGGCAAATTAAATACCAGCG
CCTGAAAAATGCACCGGGTATTGTTTCTATGGGTGAAAAAACATCCGGAATAGTAAGAAAACAACAGGGGCTTAAGCTCG
AAATCCGCCATAGCAGGGAACGCAGTGTTGTTGGTACTGGTTCTGTTCCTTTAATGCATTGA

2019-2022 IPB, CAMS&PUMC