Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

C4E49_06645


Source  Morganella morganii isolate GN28 chromosome.
Protein accession  AVD61527.1
TC component  Orphan C (Show TC locus within this genome)
Start  1413405
End  1416080
Strand  +
Product  RHS repeat protein
Protein
(HVR is highlighted in red)
MQASGLSNFRYITSLSGQVLRTESADAGISLTLHDAAGRPVISISQIRTDNGQDDRSKAVTQTFRYEGAGSAGRLLSIAE
QTAGQNAQVTERFMYAGNSEAEKAKNLAGICTHHYDPAGLMQTDCIALTGVPLSITRQLLKDADKPVNWPESNPESLLSA
EKYTTQTIADATGAVLNTTDAAGHQQKVTYDIAGLLNTSRVTVKGGAEKIIIKSVEYSAAGQKLREEHGNGVVTTYTYEP
QTQRLIAVKTEHPARKNIFQDLRYEYDPVGNVLCVTNSAEETRFWHNQKVVPENRYTYDTLYQLVSATGREMASAGQQRS
SLPDISPFDKASYANYTRNYIYDRAGNMTQIRHSAPKTGNNHTTDITVSQRSNRAVLKTLADTPEKAEALFTPGGQQTQL
QPGQTLSWTARGELQQVTPVVRNGAAGDRESYRYDAGSQRILKTTVQETGSRTQTQQVIYLPGLELHSGKENYQVICAGV
AGRAQVRLLHWQDGKKDHQRFSYDNLIGSSGLETDGDGKLLSQEEYYPFGGTAVLVADADSGIDYKTHRYSGKERDATGL
YYYGYRYYQPWAGRWLSSDPAGTVDGLNLYSMVRNNPVSFSDEQGLVAYPRTQIPGTSLYQPGINTGSDREIRGAKLIPP
AANTVTELFKGEPVRLDDVLADSTLQQTPLLTDLINPAKVKMDSSTRSSLSAVKGGIMEFNAVHIPAGNNGINALRIIDT
ETSAFQRGKGTTLAYWVPQGGYADIPAHPENGQPQLVFTPGFSGCSFVADKLDDTTIRVRHVQGGKEDAEYNRLHASEHG
HGMIGAMEYRDYGYHENYSGAVLENIQGSAFMKYEGDSWQIKYQRLKNAPGIVSMGEKTSGIVRKQQGLKLEIRHSRERS
VVGTGSVPLMH
DNA ATGCAGGCATCCGGGCTGAGCAATTTCCGCTATATCACCTCACTCTCCGGACAGGTGCTGCGTACGGAAAGTGCGGATGC
GGGAATATCGCTGACACTGCATGATGCGGCAGGGCGACCTGTGATCAGCATCAGTCAGATCCGTACGGATAACGGGCAGG
ATGACCGCAGCAAGGCCGTGACTCAGACTTTCCGGTATGAAGGTGCGGGTTCAGCCGGGCGTCTGCTGAGTATCGCGGAA
CAGACCGCCGGGCAGAATGCTCAGGTGACTGAACGCTTTATGTATGCAGGCAACAGTGAGGCGGAGAAAGCAAAAAACCT
CGCGGGTATCTGTACACACCATTATGATCCGGCGGGGCTGATGCAGACGGACTGCATTGCGCTGACCGGCGTGCCGTTAT
CCATAACCCGTCAGTTGCTGAAAGATGCGGATAAGCCGGTTAACTGGCCGGAAAGCAATCCGGAGAGTTTGCTGTCAGCC
GAAAAATACACCACACAAACCATTGCAGATGCTACCGGTGCGGTGCTGAACACCACAGATGCCGCGGGTCATCAGCAAAA
AGTGACTTATGATATCGCCGGATTACTGAACACCAGCCGGGTAACGGTGAAAGGCGGGGCAGAAAAGATCATCATCAAGT
CTGTGGAATATTCTGCCGCCGGGCAGAAGCTGCGCGAGGAGCACGGCAACGGCGTAGTGACCACGTACACTTATGAACCA
CAGACACAGCGGCTGATTGCCGTCAAAACTGAACATCCGGCACGGAAAAATATATTTCAGGATCTGCGTTATGAATACGA
TCCGGTCGGCAATGTGCTGTGTGTGACCAATAGCGCCGAGGAGACGCGCTTCTGGCATAATCAGAAAGTGGTGCCGGAAA
ACCGGTACACTTACGACACCCTGTATCAGCTGGTCAGCGCCACCGGGCGCGAGATGGCCAGTGCCGGACAGCAACGCAGT
TCCCTCCCTGATATTTCCCCGTTTGATAAAGCCAGTTACGCCAATTACACCCGCAACTATATCTATGATCGTGCCGGGAA
TATGACACAAATCCGTCATTCAGCACCGAAGACCGGCAATAACCACACCACGGATATCACCGTCAGCCAGCGCAGCAACC
GCGCGGTACTGAAAACCCTGGCGGACACGCCGGAGAAAGCGGAAGCCCTGTTTACCCCGGGCGGACAACAGACACAGTTA
CAGCCGGGACAAACTCTGTCATGGACTGCGCGCGGCGAACTGCAACAGGTTACGCCGGTGGTGCGTAACGGTGCCGCCGG
TGACCGCGAAAGCTACCGTTATGATGCGGGCAGCCAGCGTATCCTGAAAACCACCGTGCAGGAAACCGGTAGCAGAACAC
AGACACAGCAGGTCATCTATCTGCCGGGGCTGGAGCTGCACAGCGGAAAAGAAAACTATCAGGTGATCTGCGCCGGTGTT
GCCGGGCGGGCACAGGTGCGGCTGCTGCACTGGCAGGACGGTAAGAAAGATCACCAGCGGTTCAGTTATGACAATCTGAT
CGGCAGCAGCGGCCTGGAAACGGACGGTGACGGTAAGCTGCTTAGTCAGGAGGAATATTATCCGTTCGGCGGCACGGCGG
TGCTGGTGGCGGATGCGGACAGCGGCATTGACTACAAAACCCACCGTTATTCCGGCAAAGAGCGGGATGCGACCGGGCTG
TATTACTACGGCTACCGCTATTATCAGCCGTGGGCAGGCCGCTGGCTGAGTTCAGACCCGGCAGGAACCGTTGACGGACT
GAATCTGTATTCAATGGTGAGGAATAATCCGGTGTCATTTTCTGATGAACAGGGGCTTGTTGCTTATCCGCGCACACAAA
TTCCCGGAACATCTCTTTATCAACCGGGTATCAATACAGGCAGTGACAGGGAAATTCGGGGCGCTAAGTTGATACCTCCG
GCAGCGAACACGGTTACTGAATTATTTAAAGGAGAACCCGTCAGGCTGGATGATGTATTAGCTGACAGTACATTACAGCA
AACACCTCTGCTTACTGACCTGATTAACCCGGCGAAGGTAAAAATGGACAGTTCGACGCGAAGTTCTCTTTCTGCTGTTA
AAGGCGGAATAATGGAATTTAATGCTGTTCATATACCGGCCGGAAATAACGGTATCAATGCATTACGGATTATTGATACC
GAAACATCGGCTTTCCAGAGAGGGAAAGGAACAACATTAGCATATTGGGTTCCGCAAGGAGGATATGCGGATATTCCTGC
CCATCCTGAAAATGGTCAGCCTCAGTTGGTATTCACGCCGGGGTTCAGCGGGTGCTCGTTTGTTGCTGATAAACTGGATG
ATACGACTATCAGGGTACGACATGTTCAGGGAGGTAAAGAAGATGCCGAGTATAACAGATTACATGCGTCTGAGCATGGG
CATGGAATGATTGGAGCAATGGAATATCGCGACTACGGATATCATGAAAACTACAGCGGAGCAGTTCTGGAAAATATCCA
GGGATCAGCATTTATGAAATATGAAGGAGACTCATGGCAAATTAAGTACCAGCGCCTGAAAAATGCACCGGGTATTGTTT
CTATGGGTGAAAAAACATCCGGAATAGTAAGAAAACAACAGGGGCTTAAGCTCGAAATCCGCCATAGCAGGGAACGCAGT
GTTGTTGGTACTGGTTCTGTTCCTTTAATGCATTGA

2019-2022 IPB, CAMS&PUMC