Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

C1O70_13360


Source  Morganella morganii strain KC-Tt-01 chromosome, complete genome.
Protein accession  AUR33408.1
TC component  Orphan C (Show TC locus within this genome)
Start  2806161
End  2808836
Strand  -
Product  type IV secretion protein Rhs
Protein
(HVR is highlighted in red)
MQASGLSNFRYVTSLSGQVLCTESADAGISLTLNDAAGRLMISISQICTDKGQDNCSKAVTQTFRYEGADSAGRLLSITE
QTAGQNAQVTERFMYAGNSEAEKAKNLAGICTHHYDPAGLMQTDSIALTGVPLSITRQLLKDADKPVSWPESNPQTLLSA
EKYTTQTIADATGAVLNTTDAAGHQQKVTYDIAGLLRTSRVTVKGGAEKIIIKSVTYSAAGQKLCEEHGNGVVTTYTYEP
QTQRLIAVKTEHPARKKIFQDLRYEYDPVGNVLCVTNSAEETRFWHNQKVVPENRYTYDTLYQLVSATGREMANAGQQRS
SLPDISPFDKASYANYTRNYIYDRAGNMTQIRHSAPKTGNNHTTDITVSQRSNRAVLKTLADTPEKVEDLFTPGGQQTKF
QPGQTLSWTARGELQQVTPVVRNGAAGDRESYRYDAGSQRILKTTVQETGSRTQTQQVIYLPGLELHSGKENYQVICAGV
AGRAQVRLLHWQDGKKDHQRFSYDNLIGSSGLETDGDGKLLSQEEYYPFGGTAVLVADADSGIDYKTHRYSGKERDATGL
YYYGYRYYQPWAGRWLSSDPAGTVDGLNLYSMVRNNPVSFSDEQGLVAYPRTQIPGTSLYQPGINTGSDREIRGAKLIPP
AANTVTELFKGEPVRLDDVLADSTLQQTPLLTDLINPAKVKMDSSTRSSLSAVKGGIMEFNAVHIPAGNNGINALRIIDT
ETSAFQRGKGTTLAYWVPQGGYADIPAHPENGQPQLVFTPGFSGCSFVADKLDDTTIRVRHVQGGKEDAEYNRLHASEHG
HGMIGAMEYRDYGYHENYSGAVLENIQGSAFMKYEGDSWQIKYQRLKNAPGIVSMGEKTSGIVRKQQGLKLEIRHSRERS
VVGTGSVPLMH
DNA ATGCAGGCATCCGGGCTGAGCAATTTCCGCTATGTCACCTCACTCTCCGGACAGGTGCTGTGTACGGAAAGCGCGGATGC
AGGAATATCGCTGACACTGAATGATGCGGCAGGGCGACTGATGATCAGCATCAGTCAGATCTGCACGGATAAGGGGCAGG
ATAACTGCAGCAAGGCCGTGACTCAGACTTTCCGGTATGAAGGTGCGGATTCAGCCGGGCGTCTGCTGAGTATCACTGAA
CAGACCGCCGGGCAGAACGCTCAGGTAACTGAACGTTTTATGTATGCAGGCAACAGTGAGGCGGAGAAAGCAAAAAACCT
CGCGGGTATCTGTACACACCATTATGATCCGGCCGGGCTGATGCAGACGGACAGCATTGCGCTGACCGGCGTGCCGTTAT
CCATAACCCGTCAGTTGCTGAAAGATGCGGATAAGCCGGTTAGCTGGCCGGAAAGCAATCCGCAAACATTATTATCTGCT
GAAAAATACACCACACAAACCATTGCAGATGCGACCGGTGCGGTGCTGAACACCACGGATGCGGCGGGTCATCAGCAAAA
AGTGACTTATGATATCGCCGGATTACTGCGCACCAGCCGGGTGACGGTGAAAGGCGGAGCGGAAAAAATCATTATCAAAT
CTGTGACGTATTCCGCTGCCGGGCAGAAGCTGTGTGAGGAGCACGGTAACGGTGTAGTGACCACTTACACTTATGAACCG
CAAACCCAGCGCCTGATTGCTGTCAAAACCGAACATCCGGCACGGAAAAAAATATTTCAGGATCTGCGTTATGAATACGA
TCCGGTCGGCAATGTGCTGTGTGTGACCAATAGCGCCGAGGAGACGCGATTCTGGCATAATCAGAAAGTGGTGCCGGAAA
ACCGATACACTTACGACACCCTGTATCAGCTGGTCAGCGCCACCGGGCGCGAGATGGCCAATGCCGGACAGCAACGCAGT
TCCCTGCCGGATATTTCCCCGTTTGATAAAGCCAGTTACGCCAATTACACCCGCAACTATATCTATGATCGTGCCGGGAA
TATGACACAAATCCGTCATTCAGCACCGAAGACCGGCAATAACCACACCACGGATATCACCGTCAGCCAGCGCAGCAACC
GCGCGGTACTGAAAACCCTGGCGGACACACCGGAGAAAGTGGAAGACCTGTTTACCCCGGGCGGGCAGCAGACAAAATTC
CAGCCCGGACAAACTCTGTCATGGACTGCGCGCGGCGAACTGCAACAGGTTACGCCGGTGGTGCGTAACGGTGCCGCCGG
TGACCGCGAAAGCTACCGTTATGATGCGGGCAGCCAGCGTATCCTGAAAACCACCGTGCAGGAAACCGGTAGCAGAACAC
AGACACAGCAGGTCATCTATCTGCCGGGGCTGGAGCTGCACAGCGGAAAAGAAAACTATCAGGTGATCTGCGCCGGTGTT
GCCGGGCGGGCACAGGTGCGGCTGCTGCACTGGCAGGACGGTAAGAAAGATCACCAGCGGTTCAGTTATGACAATCTGAT
CGGCAGCAGCGGCCTGGAAACGGACGGTGACGGTAAGCTGCTTAGTCAGGAGGAATATTATCCGTTCGGCGGCACGGCGG
TGCTGGTGGCGGATGCGGACAGCGGCATTGACTACAAAACCCACCGTTATTCCGGCAAAGAGCGGGATGCGACCGGGCTG
TATTACTACGGCTACCGCTATTATCAGCCGTGGGCAGGGCGCTGGCTGAGTTCAGATCCTGCGGGAACTGTTGACGGACT
GAATCTGTATTCAATGGTGAGGAATAATCCGGTGTCATTTTCTGATGAACAGGGGCTTGTTGCTTATCCGCGCACACAAA
TTCCCGGAACATCTCTTTATCAACCGGGTATCAATACAGGCAGTGACAGGGAAATTCGGGGCGCTAAGTTGATACCTCCG
GCAGCGAACACGGTTACTGAATTATTTAAAGGAGAACCCGTCAGGCTGGATGATGTATTAGCTGACAGTACATTACAGCA
AACACCTCTGCTTACTGACCTGATTAACCCGGCGAAGGTAAAAATGGACAGTTCGACGCGAAGTTCTCTTTCTGCCGTTA
AAGGCGGAATAATGGAATTTAATGCTGTTCATATACCGGCCGGAAATAACGGTATCAATGCATTACGGATTATTGATACC
GAAACATCGGCTTTCCAGAGAGGGAAAGGAACAACATTAGCATATTGGGTTCCGCAAGGAGGATATGCGGATATTCCTGC
CCATCCTGAAAATGGTCAGCCTCAGTTGGTATTCACGCCGGGGTTCAGCGGGTGCTCGTTTGTTGCTGATAAACTGGATG
ATACGACTATCAGGGTACGACATGTTCAGGGAGGTAAAGAAGATGCCGAGTATAACAGATTACATGCGTCTGAGCATGGG
CATGGAATGATTGGAGCAATGGAATATCGCGACTACGGATATCATGAAAACTACAGCGGAGCAGTTCTGGAAAATATCCA
GGGATCAGCATTTATGAAATATGAAGGAGACTCATGGCAAATTAAATACCAGCGCCTGAAAAATGCACCGGGTATTGTTT
CTATGGGTGAAAAAACATCCGGAATAGTAAGAAAACAACAGGGGCTTAAGCTCGAAATCCGCCATAGCAGGGAACGCAGT
GTTGTTGGTACTGGTTCTGTTCCTTTAATGCATTGA

2019-2022 IPB, CAMS&PUMC