Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

A4R40_22220


Source  Photorhabdus luminescens subsp. laumondii strain DSPV002N chromosome, complete genome.
Protein accession  AWK44019.1
TC component  Orphan C (Show TC locus within this genome)
Start  5242612
End  5245422
Strand  +
Product  toxin
Protein
(HVR is highlighted in red)
MIRYNSAINRNTPSVSVRDNRGLNIHTLEYLRTQADETNSNELITRYQFNTHGLQVKSTDPRRYKNQSGSNFTRIFSLAG
NTLREESIDAGRTITLNDIEGRPVLTINAIGARQTHHYEGNTLPGRLLAVTELIQKNEKTTERLIWANNTDAEKNQNLAG
QCIRHYDPAGLVQLESLSLTGSVLSQSRQLIADDQEADWRGDDENSWRTKLNGNIFTTQHKTDAIGALLTQIDAKGNMQR
LAYDVAGQLKGSWLTLKGQAEKVIVQSITWSAAGQKLREEHGNGVITEYTYEPETQRLINITTRRTRDSTKPLQDLRYEY
DPVGNVINIRNDAEATRFWRNQKIVPENAYSYDSLYQLIQATGREMANIGQQGSQLPPLITPLPTDDNTYTNYIRTYTYD
DSGNLTQIQHSAPASNNNYTTNITISNRNNRGVLSTLTNDPNLVDTFFDAGGHQTSLFSGQSLNWTPRGELQQVNQSGNT
AREWYHYDSDGMRLLKINEQQTSNTTQQQRVTYLPGLELHTTQSGTNITEDLQVITVRQAGKAQVRVLHWEKGQPTGINN
DQVRYSYDNLTHSSELELDMHGEMISWEEYYPYGGTAVWAARNQIEAGYKTIRYSGKERDATGLYYYGYRYYQPWAGRWL
SADPAGTVDGLNLYRMVRNNPMTGIDEDGRMFKTVATGALGIGGMAYELYKYKNQQVEKPQMPSPVSESYGDQQVSKITQ
KASALKANYDPMKQMAHNITGRKEAAEHLAQGQVPGAQAIKEGASLVAAAGEFAAAGNVGELNKTTLTKAAGTDAINNFS
LTLDGIKKVFKAGAASATVSPEKLEELQKATDDLKEVATDTLITGASLGATVGATLDTAAAVVPHPVAKVALKGLSLAWK
VTGIVHTAEELSELAEKHKDLVSNELGQELKREVTEANQIRRGTILAKVREHGLIK
DNA ATGATTCGTTACAATTCTGCAATTAACCGAAATACCCCATCTGTCAGCGTACGAGATAATCGAGGGTTAAATATACATAC
GCTGGAATATCTGCGGACTCAAGCTGATGAAACCAATAGCAACGAATTGATCACTCGCTATCAATTTAATACTCACGGAC
TTCAAGTAAAAAGCACAGACCCACGTAGATATAAAAACCAGAGTGGTTCAAACTTCACTCGTATCTTTAGTCTCGCTGGG
AATACACTGCGTGAAGAAAGTATCGATGCTGGCCGAACGATTACCTTGAACGATATCGAAGGACGCCCAGTACTGACTAT
CAATGCAATCGGCGCTCGTCAGACCCATCACTATGAAGGTAATACCTTGCCCGGCCGCTTGCTGGCTGTCACCGAGTTAA
TACAAAAGAACGAGAAAACCACGGAGCGCCTTATTTGGGCAAACAATACAGATGCAGAGAAAAACCAGAATCTCGCCGGG
CAATGTATACGCCATTATGATCCTGCGGGGCTGGTACAACTGGAAAGTTTGTCCTTAACAGGATCGGTTTTATCACAGTC
TCGTCAATTAATAGCCGACGATCAGGAAGCTGATTGGCGCGGTGATGATGAAAATAGCTGGCGTACAAAACTGAATGGCA
ACATATTCACGACTCAACATAAAACTGATGCCATTGGTGCTCTGCTAACTCAAATCGACGCCAAGGGAAATATGCAACGG
CTGGCCTATGATGTCGCGGGCCAACTGAAAGGTAGCTGGTTAACACTAAAAGGCCAAGCCGAAAAAGTTATTGTACAGTC
TATTACCTGGTCAGCAGCCGGACAAAAATTACGAGAAGAGCACGGTAATGGCGTTATTACGGAATATACCTATGAACCAG
AGACCCAACGATTAATTAACATTACAACCCGCCGAACTAGAGATAGTACAAAACCACTACAAGATTTACGTTATGAATAT
GATCCCGTTGGCAATGTGATCAATATTCGTAATGATGCAGAAGCAACCCGATTCTGGCGTAATCAGAAAATAGTACCGGA
AAATGCATATTCCTATGATTCTCTGTACCAACTCATCCAAGCAACCGGCCGCGAAATGGCTAACATTGGTCAGCAAGGAA
GCCAGCTCCCTCCTTTAATTACCCCTCTTCCTACCGATGACAATACTTATACTAACTATATTCGTACTTATACCTACGAC
GATAGCGGCAACCTGACACAAATCCAGCACAGTGCTCCGGCAAGTAACAATAACTACACCACAAATATCACCATTTCAAA
CCGTAATAACCGCGGTGTCCTCAGTACCCTCACCAACGACCCCAATCTCGTTGATACATTCTTTGATGCAGGTGGTCATC
AAACCAGTCTGTTCTCAGGGCAATCCTTAAACTGGACACCACGGGGAGAACTACAACAAGTGAACCAAAGTGGTAATACC
GCGCGTGAGTGGTACCACTATGACAGTGACGGCATGCGGCTACTGAAAATAAACGAACAGCAAACATCCAATACCACGCA
GCAGCAACGAGTCACTTATCTGCCAGGGTTGGAATTACACACCACACAAAGCGGCACCAATATCACCGAAGACTTACAAG
TTATTACTGTCAGGCAAGCAGGAAAAGCACAAGTACGCGTACTACACTGGGAAAAAGGCCAACCCACCGGCATAAATAAC
GATCAAGTCAGATATAGCTACGATAATCTTACACACAGCAGCGAATTAGAACTGGATATGCACGGAGAAATGATCAGTTG
GGAAGAGTATTACCCCTATGGTGGCACCGCAGTATGGGCAGCAAGAAATCAGATTGAAGCTGGTTACAAAACCATTCGTT
ATTCAGGTAAAGAACGTGATGCAACGGGACTGTACTATTACGGCTACCGCTATTATCAACCGTGGGCCGGTAGATGGTTA
AGCGCTGACCCGGCTGGAACCGTAGATGGTCTGAATTTGTACCGTATGGTAAGAAATAATCCAATGACCGGCATAGATGA
AGATGGGCGTATGTTTAAAACCGTAGCAACAGGTGCATTAGGCATTGGCGGTATGGCATACGAGCTTTACAAATATAAAA
ATCAACAAGTTGAAAAGCCTCAGATGCCATCTCCTGTCTCTGAATCCTACGGTGATCAACAAGTCAGCAAAATCACCCAA
AAAGCGAGTGCTTTAAAAGCAAACTATGACCCGATGAAGCAGATGGCCCATAACATAACGGGGCGTAAAGAAGCCGCAGA
ACATCTCGCACAGGGTCAAGTCCCTGGCGCTCAAGCAATAAAAGAAGGGGCAAGCTTAGTCGCGGCTGCCGGAGAATTTG
CTGCGGCTGGCAATGTCGGTGAACTAAACAAAACCACGCTAACAAAAGCCGCCGGCACCGACGCAATTAATAATTTTAGT
CTCACCTTGGACGGTATAAAAAAGGTATTTAAGGCAGGCGCGGCTAGTGCTACCGTCAGCCCAGAAAAATTGGAAGAGCT
GCAAAAAGCAACTGATGATTTAAAAGAGGTCGCAACAGATACGCTAATTACCGGGGCATCGCTAGGTGCGACAGTCGGAG
CCACACTGGATACCGCCGCCGCGGTCGTGCCACACCCGGTAGCCAAAGTGGCACTCAAAGGTCTGTCATTGGCATGGAAA
GTTACCGGCATTGTTCACACCGCAGAAGAATTAAGCGAGCTCGCAGAAAAACATAAGGATCTGGTTTCTAATGAGCTAGG
ACAAGAATTAAAAAGGGAGGTCACCGAGGCAAACCAAATTAGGCGGGGAACCATTCTCGCAAAAGTTAGAGAACACGGTT
TGATAAAATAG

2019-2022 IPB, CAMS&PUMC