Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

MC49_000555


Source  Morganella morganii strain FDAARGOS_63 chromosome, complete genome.
Protein accession  AUU02139.1
TC component  Orphan C (Show TC locus within this genome)
Start  96455
End  99130
Strand  -
Product  RHS repeat protein
Protein
(HVR is highlighted in red)
MQASGLSNFRYITSLSGQVLRTESADAGISLTLHDAAGRPVISISQIRTDNGQDDRSKAVTQTFRYEGAGSAGRLLSIAE
QTAGQNAQVTERFMYAGNSEAEKAKNLAGICTHHYDPAGLMQTDCIALTGVPLSITRQLLKDADKPVNWPESNPESLLSA
EKYTTQTIADATGAVLNTTDAAGHQQKVTYDIAGLLNTSRVTVKGGAEKIIIKSVEYSAAGQKLREEHGNGVVTTYTYEP
QTQRLIAVKTEHPARKNIFQDLRYEYDPVGNVLCVTNSAEETRFWHNQKVVPENRYTYDTLYQLVSATGREMASAGQQRS
SLPDISPFDKASYANYTRNYIYDRAGNMTQIRHSAPKTGNNHTTDITVSQRSNRAVLKTLADTPEKAEALFTPGGQQTQL
QPGQTLSWTARGELQQVTPVVRNGAAGDRESYRYDAGSQRILKTTVQETGSRTQTQQVIYLPGLELHSGKENYQVICAGV
AGRAQVRLLHWQDGKKDHQRFSYDNLIGSSGLETDGDGKLLSQEEYYPFGGTAVLVADADSGIDYKTHRYSGKERDATGL
YYYGYRYYQPWAGRWLSSDPAGTVDGLNLYSMVRNNPVSFSDEQGLVAYPRTQIPGTSLYQPGINTGSDREIRGAKLIPP
AANTVTELFKGEPVRLDDVLADSTLQQTPLLTDLINPAKVKMDSSTRSSLSAVKGGIMEFNAVHIPAGNNGINALRIIDT
ETSAFQRGKGTTLAYWVPQGGYADIPAHPENGQPQLVFTPGFSGCSFVADKLDDTTIRVRHVQGGKEDAEYNRLHASEHG
HGMIGAMEYRDYGYHENYSGAVLENIQGSAFMKYEGDSWQIKYQRLKNAPGIVSMGEKTSGIVRKQQGLKLEIRHSRERS
VVGTGSVPLMH
DNA ATGCAGGCATCCGGGCTGAGCAATTTCCGCTATATCACCTCACTCTCCGGACAGGTGCTGCGTACGGAAAGTGCGGATGC
GGGAATATCGCTGACACTGCATGATGCGGCAGGGCGACCTGTGATCAGCATCAGTCAGATCCGTACGGATAACGGGCAGG
ATGACCGCAGCAAGGCCGTGACTCAGACTTTCCGGTATGAAGGTGCGGGTTCAGCCGGGCGTCTGCTGAGTATCGCGGAA
CAGACCGCCGGGCAGAATGCTCAGGTGACTGAACGCTTTATGTATGCAGGCAACAGTGAGGCGGAGAAAGCAAAAAACCT
CGCGGGTATCTGTACACACCATTATGATCCGGCGGGGCTGATGCAGACGGACTGCATTGCGCTGACCGGCGTGCCGTTAT
CCATAACCCGTCAGTTGCTGAAAGATGCGGATAAGCCGGTTAACTGGCCGGAAAGCAATCCGGAGAGTTTGCTGTCAGCC
GAAAAATACACCACACAAACCATTGCAGATGCTACCGGTGCGGTGCTGAACACCACAGATGCCGCGGGTCATCAGCAAAA
AGTGACTTATGATATCGCCGGATTACTGAACACCAGCCGGGTAACGGTGAAAGGCGGGGCAGAAAAGATCATCATCAAGT
CTGTGGAATATTCTGCCGCCGGGCAGAAGCTGCGCGAGGAGCACGGCAACGGCGTAGTGACCACGTACACTTATGAACCA
CAGACACAGCGGCTGATTGCCGTCAAAACTGAACATCCGGCACGGAAAAATATATTTCAGGATCTGCGTTATGAATACGA
TCCGGTCGGCAATGTGCTGTGTGTGACCAATAGCGCCGAGGAGACGCGCTTCTGGCATAATCAGAAAGTGGTGCCGGAAA
ACCGGTACACTTACGACACCCTGTATCAGCTGGTCAGCGCCACCGGGCGCGAGATGGCCAGTGCCGGACAGCAACGCAGT
TCCCTCCCTGATATTTCCCCGTTTGATAAAGCCAGTTACGCCAATTACACCCGCAACTATATCTATGATCGTGCCGGGAA
TATGACACAAATCCGTCATTCAGCACCGAAGACCGGCAATAACCACACCACGGATATCACCGTCAGCCAGCGCAGCAACC
GCGCGGTACTGAAAACCCTGGCGGACACGCCGGAGAAAGCGGAAGCCCTGTTTACCCCGGGCGGACAACAGACACAGTTA
CAGCCGGGACAAACTCTGTCATGGACTGCGCGCGGCGAACTGCAACAGGTTACGCCGGTGGTGCGTAACGGTGCCGCCGG
TGACCGCGAAAGCTACCGTTATGATGCGGGCAGCCAGCGTATCCTGAAAACCACCGTGCAGGAAACCGGTAGCAGAACAC
AGACACAGCAGGTCATCTATCTGCCGGGGCTGGAGCTGCACAGCGGAAAAGAAAACTATCAGGTGATCTGCGCCGGTGTT
GCCGGGCGGGCACAGGTGCGGCTGCTGCACTGGCAGGACGGTAAGAAAGATCACCAGCGGTTCAGTTATGACAATCTGAT
CGGCAGCAGCGGCCTGGAAACGGACGGTGACGGTAAGCTGCTTAGTCAGGAGGAATATTATCCGTTCGGCGGCACGGCGG
TGCTGGTGGCGGATGCGGACAGCGGCATTGACTACAAAACCCACCGTTATTCCGGCAAAGAGCGGGATGCGACCGGGCTG
TATTACTACGGCTACCGCTATTATCAGCCGTGGGCAGGCCGCTGGCTGAGTTCAGACCCGGCAGGAACCGTTGACGGACT
GAATCTGTATTCAATGGTGAGGAATAATCCGGTGTCATTTTCTGATGAACAGGGGCTTGTTGCTTATCCGCGCACACAAA
TTCCCGGAACATCTCTTTATCAACCGGGTATCAATACAGGCAGTGACAGGGAAATTCGGGGCGCTAAGTTGATACCTCCG
GCAGCGAACACGGTTACTGAATTATTTAAAGGAGAACCCGTCAGGCTGGATGATGTATTAGCTGACAGTACATTACAGCA
AACACCTCTGCTTACTGACCTGATTAACCCGGCGAAGGTAAAAATGGACAGTTCGACGCGAAGTTCTCTTTCTGCTGTTA
AAGGCGGAATAATGGAATTTAATGCTGTTCATATACCGGCCGGAAATAACGGTATCAATGCATTACGGATTATTGATACC
GAAACATCGGCTTTCCAGAGAGGGAAAGGAACAACATTAGCATATTGGGTTCCGCAAGGAGGATATGCGGATATTCCTGC
CCATCCTGAAAATGGTCAGCCTCAGTTGGTATTCACGCCGGGGTTCAGCGGGTGCTCGTTTGTTGCTGATAAACTGGATG
ATACGACTATCAGGGTACGACATGTTCAGGGAGGTAAAGAAGATGCCGAGTATAACAGATTACATGCGTCTGAGCATGGG
CATGGAATGATTGGAGCAATGGAATATCGCGACTACGGATATCATGAAAACTACAGCGGAGCAGTTCTGGAAAATATCCA
GGGATCAGCATTTATGAAATATGAAGGAGACTCATGGCAAATTAAGTACCAGCGCCTGAAAAATGCACCGGGTATTGTTT
CTATGGGTGAAAAAACATCCGGAATAGTAAGAAAACAACAGGGGCTTAAGCTCGAAATCCGCCATAGCAGGGAACGCAGT
GTTGTTGGTACTGGTTCTGTTCCTTTAATGCATTGA

2019-2022 IPB, CAMS&PUMC