Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

PAU_00880


Source  Photorhabdus asymbiotica ATCC43949 complete genome.
Protein accession  CAQ82972.1
TC component  Orphan C (Show TC locus within this genome)
Gene  tccC2
Start  984925
End  987708
Strand  -
Product  insecticidal toxin complex protein tccc2
Protein
(HVR is highlighted in red)
MSSYHSAISQKTPSINVLDNRGRNIRTLEYLRTQADENSNELITLYEFNIQGFQVKGTDPRKNKDQSGPNFTRIFNLAGN
VLREESVDAGQTITLNDIEGRPVFTINATGARHNHHYEGNTLPGRLLTITEQIQTEEKIIERLIWAGNTTTEKNNNLSGQ
CTHHYDTAGLTQLNNLSLTGAVSSQSQQLLIDGQVADWTGEDQSIWQKKLSNDIYTTQNKTDATGALLTQTDATGNIQRL
AYDVAGQLKGSWLTLKGQNEQIIVKSLTYSAAGQKLREEHGNGVITEYTYEPETQRLIGITTRRLSDTKVLQDLRYEYDP
VGNVISINNDAEATRFWRNQKVVPKNTYTYDSLYQLISATGREMANIGQQSHQLPSPVLPSDNNSYTNYTRSYSYDHSGN
LLQIRHHSAATQNSYTKDITVSNRSNRGVLSTLTTDRNKVDTLFDAGGHQTSLLPGQTLVWTPQGELQQVNNGTGNEWYR
YGRDGIRRLKVSEQQTQNTTQQQRVTYLPGLELRITQNSTTITENQQVITVGKAGHAQVRVLHWENGKPEAISNNQLRYS
YDNLIGSSQLELDHEGQIISQEEYYPFGGTALWAANNQTETSYKTIRYSGKERDATGLYYYGYRYYQPWAGRWLSADPAG
TVDGLNLYRMVRNNPISAFDDNGLMFSKAVIKGVTSAIAAAGGLGYEAYKHANKPPETPAVEQQSISSVGNNKIHTQHLK
AAEKQQNFSLLDTVKKNFSGRGKVFSDAAEGKLPAHESVMNEGGNIAALYEFSKTGNISQLDKTSLLSNAAQDAKENIPT
RFKQATKALVTVGTTTPEGVKELAETAKKTVDVMEDTAIVGGSIALAGNAAITAAKIAFPVASIPLTIAQAAWVASSVGK
TVNDVNDVAKKHIEKSEITHNTRTDLLTQVKQINKENRQKIIFGKNE
DNA ATGAGCAGTTATCATTCCGCAATTTCTCAAAAAACTCCATCAATCAATGTATTAGATAACAGAGGAAGGAATATACGCAC
TCTGGAATACTTACGTACTCAAGCTGATGAAAACAGTAACGAGCTGATTACTCTCTATGAGTTCAATATTCAAGGGTTTC
AGGTGAAAGGTACTGATCCACGCAAAAATAAAGACCAGAGTGGCCCTAACTTCACGCGTATCTTTAATCTGGCAGGCAAT
GTTCTACGTGAAGAAAGTGTTGATGCTGGTCAGACTATCACTCTCAACGATATTGAAGGCCGCCCGGTGTTTACCATCAA
TGCAACAGGTGCCCGCCATAATCATCACTACGAAGGCAACACGCTGCCCGGTCGTCTGCTCACTATCACCGAACAAATAC
AGACAGAAGAGAAAATTATTGAGCGCCTGATCTGGGCAGGCAATACAACTACAGAAAAAAACAATAACCTTTCTGGCCAG
TGTACTCACCACTACGACACAGCAGGTTTAACCCAACTGAACAACCTTTCTCTAACTGGAGCAGTTTCATCACAATCTCA
ACAGTTATTAATCGATGGCCAAGTAGCTGATTGGACCGGTGAAGACCAAAGTATTTGGCAGAAAAAACTGAGTAATGATA
TCTACACGACTCAAAATAAAACTGATGCTACTGGCGCTTTATTGACCCAAACCGATGCAACAGGGAATATCCAGCGTTTG
GCCTATGATGTAGCTGGACAACTAAAAGGTAGCTGGTTAACACTCAAAGGCCAGAACGAACAGATTATCGTTAAATCCCT
AACTTATTCCGCCGCCGGACAAAAATTACGTGAAGAACACGGTAACGGCGTTATCACTGAATACACCTATGAACCGGAAA
CCCAACGGCTTATTGGTATCACCACCCGCCGTCTGTCAGACACCAAAGTGTTACAAGATTTACGTTATGAATATGACCCG
GTAGGTAACGTAATCAGTATCAATAATGACGCAGAAGCCACTCGCTTCTGGCGCAATCAAAAAGTTGTACCAAAGAACAC
TTATACCTACGATTCCCTGTACCAACTTATCAGTGCGACAGGGCGTGAAATGGCAAATATTGGGCAGCAAAGTCATCAGC
TCCCCTCCCCGGTTCTGCCCTCTGATAACAACAGCTACACTAACTATACCCGCAGCTACAGCTACGATCACAGCGGCAAT
CTGCTGCAAATCCGACACCATTCAGCCGCCACTCAAAATAGCTACACTAAGGACATAACGGTATCAAATCGAAGCAATCG
AGGGGTTCTCAGCACATTAACTACAGATCGAAATAAAGTTGATACACTGTTCGATGCTGGTGGACATCAAACCAGTCTGT
TGCCCGGACAAACTCTGGTCTGGACTCCACAAGGTGAGCTGCAACAAGTCAACAACGGTACAGGAAATGAATGGTATCGC
TACGGCAGAGATGGGATTCGGCGACTGAAAGTGAGCGAGCAACAAACACAGAATACTACCCAGCAACAGCGAGTCACTTA
TCTACCTGGATTGGAACTCCGCATAACACAAAATAGCACCACCATAACAGAAAACCAGCAAGTTATCACAGTCGGTAAAG
CCGGTCATGCGCAGGTCAGAGTACTACATTGGGAAAATGGTAAACCAGAAGCCATCAGCAACAATCAACTGCGCTATAGC
TACGACAACCTTATCGGCTCCAGCCAGCTTGAACTGGATCACGAAGGACAAATTATCAGTCAGGAAGAGTACTACCCATT
CGGTGGTACCGCACTATGGGCGGCAAACAATCAGACAGAAACCAGTTATAAAACCATTCGTTATTCAGGTAAAGAACGTG
ATGCAACGGGGCTATATTATTACGGCTACCGATATTATCAGCCATGGGCAGGACGGTGGTTAAGTGCTGATCCAGCAGGG
ACAGTGGATGGATTAAATTTATATCGAATGGTGAGGAATAATCCTATATCCGCATTTGATGATAATGGATTAATGTTTTC
TAAAGCGGTGATCAAAGGAGTTACTTCAGCAATAGCCGCTGCCGGTGGACTTGGCTATGAAGCCTATAAACATGCTAATA
AACCGCCAGAAACACCAGCCGTTGAACAACAATCCATTTCAAGCGTAGGTAATAATAAAATTCATACACAACATCTGAAA
GCAGCCGAAAAGCAACAAAACTTTAGTCTACTTGATACAGTGAAAAAGAACTTTTCTGGCAGAGGAAAAGTCTTCTCAGA
TGCAGCTGAAGGCAAATTACCCGCTCATGAATCAGTAATGAATGAAGGAGGAAATATCGCAGCATTATATGAGTTTTCTA
AAACGGGTAATATTTCTCAGTTGGATAAAACGAGCTTGTTGAGTAATGCCGCACAAGATGCCAAGGAAAACATTCCCACT
CGCTTTAAACAAGCTACAAAGGCATTAGTAACAGTGGGTACAACAACGCCTGAAGGTGTAAAAGAACTTGCAGAAACCGC
TAAAAAAACCGTCGATGTTATGGAGGATACCGCCATCGTTGGCGGCTCAATAGCTCTCGCAGGTAACGCTGCAATTACTG
CGGCCAAAATCGCTTTTCCTGTTGCGTCTATCCCATTAACCATTGCACAAGCAGCATGGGTTGCAAGCTCGGTAGGAAAA
ACAGTTAACGACGTTAATGATGTAGCGAAAAAGCATATTGAAAAAAGCGAAATTACGCATAACACAAGAACTGATTTATT
AACTCAAGTTAAACAAATTAACAAAGAGAACCGGCAAAAGATCATATTTGGCAAAAATGAATAA

2019-2022 IPB, CAMS&PUMC