Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

AO263_11455


Source  Pseudomonas sp. NZIPFR-PS5 scaffold65_001, whole genome shotgun sequence.
Protein accession  PHX39082.1
TC component  C (Show this TC locus)
Start  3611
End  6550
Strand  -
Product  hypothetical protein
Protein
(HVR is highlighted in red)
MNLHSKTPQLHVVDPRALLVRHIAYCRAVEGEVAEPRITRHIWDEAGRYVADQDPRFAGTGLPFNTTTTHSLSGVALLQQ
SVDAGWKLTLSGAAGQLLDSWDARGSSGHVDYDPMFRPASFTEKPADGEPAIVERFTYGDSSTESAHHNQCGQLIRHDDP
AGTLLGCEFGLAGGLLLTNRRLLLSLQLPDWPESVIERDLLLEAGEGYFSSAVVDALAEAIQQIDPAGNRRTSSYGVSGQ
LQESGIELAGTSAPQRLVSAIAYSASGQVLAQTFGNGVIREITYEPASGRTARVTAKKANGTLLSDLNYQYDPAGNVVDA
DDASQPTRFADNQKIEPVSHYRYNTLYQLIEASGREVSTGASHGPALPYAIIPIPDPNNLAKYSQTYRYDAGGNLLEMHH
AGGQAFTRKMDVAPDSNRSLPHDETDADFASGFDTNGNLQELVRGQTLEWDVRNQLRLVTTVRRQDGANDDEHYIYDGGG
QRLRKITKAQASGRTLVSEVRYLDGLEIRNQPDGEILEVATVQAGGSSVRVLHWKANKPDGIDDNQVRYELSDHLGSSTL
ELDGQGGVMTREGYYPFGGTAWWTARSAIDAKYRTVRYSGKERDATGLYYYGMRYYAPWLQRWINPDPQGSADGLNVYCF
VSNSPVSKFDTDGLVGMDANRAATVLQSRIKRFISPISVKTLTEGVISVSIKGDNAVFAKVGIELDREAAAPREFTYLSL
SSSLRGKVSGGDAAIPLSRAAGAQIADASGSMPAAYVNGGYFNMGARQAMSGPLPLPSPQLQNLEYASVGGNVIDSLQKP
FIDPPDDYSSAYSKLQLGDGSFIHVAPKLTTGGVMQFSRRDSLKTKHIYGEETGHVGALGHASDPNARSAISLAENNTAR
TRLAIALNQGRGTFSRKTDEPGFTMLEWATVMARLDNLNPINERGPPAASSWNLDGGDSSTLGVLDPSGTHLLQVHTLKY
GRSGVKSARPIGNFLTFHR
HVR cluster:
putative toxin domain
 TCHC_014:
 Unknown
DNA ATGAACCTGCACAGTAAAACCCCACAGTTACACGTCGTCGACCCGCGTGCCTTGTTGGTGCGGCATATCGCCTATTGCCG
AGCAGTCGAAGGGGAGGTCGCCGAGCCACGCATCACGCGACATATCTGGGATGAAGCGGGTCGGTACGTTGCCGATCAGG
ATCCGCGCTTCGCGGGCACGGGATTGCCGTTCAATACCACTACCACTCACTCGCTATCCGGCGTAGCACTTCTGCAGCAG
AGCGTCGACGCGGGCTGGAAGCTGACACTGAGCGGAGCTGCCGGCCAGTTACTGGACAGCTGGGACGCCAGAGGCAGCAG
TGGTCACGTCGATTACGATCCGATGTTTCGTCCCGCATCATTCACTGAAAAACCGGCGGATGGCGAGCCTGCAATTGTCG
AACGCTTCACCTATGGCGACAGTTCGACGGAATCGGCGCACCACAATCAATGCGGTCAACTGATACGCCATGACGATCCG
GCAGGCACACTGCTGGGGTGTGAATTCGGGTTGGCGGGCGGCTTACTGCTGACAAATCGGCGACTGCTGCTCAGCCTGCA
ATTACCGGACTGGCCAGAAAGCGTCATTGAACGCGATTTGCTGCTCGAAGCAGGCGAAGGGTATTTCAGCTCGGCCGTTG
TCGATGCGCTGGCGGAGGCCATCCAACAGATCGACCCGGCCGGCAATCGGCGCACATCATCCTATGGCGTCAGCGGCCAG
CTTCAGGAATCCGGGATAGAACTGGCGGGCACATCGGCTCCTCAGCGCCTGGTCAGCGCAATCGCGTACAGCGCCAGCGG
CCAGGTCTTGGCGCAAACTTTCGGTAACGGGGTCATCCGCGAAATCACCTACGAGCCAGCAAGTGGACGTACAGCTCGAG
TGACCGCTAAAAAAGCCAATGGCACGCTGCTGTCGGACTTGAACTATCAATACGATCCCGCGGGCAACGTCGTTGACGCT
GACGACGCCAGCCAGCCGACCCGTTTTGCTGACAACCAGAAGATTGAGCCCGTCAGTCACTACCGTTACAACACTCTCTA
TCAACTGATAGAAGCCAGTGGGCGTGAGGTCTCGACCGGTGCCAGTCACGGCCCCGCCTTGCCCTACGCGATCATCCCGA
TTCCGGATCCTAATAACCTGGCCAAGTACTCCCAGACTTACCGCTACGACGCAGGGGGCAACCTGCTGGAAATGCATCAT
GCTGGTGGGCAAGCCTTCACGCGCAAAATGGACGTTGCACCCGACAGCAACCGCAGCCTGCCCCACGATGAAACCGACGC
GGACTTTGCATCCGGATTCGACACAAATGGCAATCTGCAGGAACTGGTTCGCGGCCAGACCCTGGAATGGGACGTGCGCA
ACCAACTACGGTTGGTCACGACCGTGCGCCGGCAGGACGGAGCAAACGATGACGAACATTATATTTATGACGGCGGGGGC
CAGCGCTTGCGCAAGATCACAAAAGCGCAAGCGAGTGGCCGAACGCTGGTATCCGAGGTCCGCTACCTCGATGGGCTGGA
AATCCGCAACCAGCCGGATGGAGAGATTCTGGAAGTGGCAACTGTTCAGGCAGGAGGCAGCAGCGTACGAGTTTTGCACT
GGAAGGCCAATAAGCCCGATGGGATTGATGACAATCAGGTGCGTTATGAGTTGAGTGATCATCTGGGCTCCAGCACGCTG
GAGCTGGACGGCCAGGGTGGCGTCATGACCCGGGAAGGTTATTACCCGTTTGGCGGCACCGCCTGGTGGACCGCGCGTAG
CGCCATTGACGCCAAATACCGAACTGTTCGCTACAGCGGCAAAGAGCGCGATGCCACAGGGCTCTATTACTACGGCATGC
GTTATTACGCACCGTGGTTACAGCGATGGATAAACCCCGATCCGCAAGGCAGTGCCGATGGGTTGAATGTCTACTGCTTC
GTCAGCAACTCGCCTGTGAGCAAGTTCGATACCGATGGGCTGGTGGGTATGGACGCGAATCGGGCCGCAACCGTGTTGCA
GAGTCGAATCAAGAGATTTATATCGCCCATTAGCGTTAAAACACTTACTGAAGGCGTTATCAGCGTATCGATAAAAGGGG
ATAACGCTGTATTCGCAAAAGTCGGCATTGAGCTTGATCGCGAAGCGGCAGCGCCACGCGAATTCACCTACCTGTCTCTG
AGTAGCAGTCTTAGGGGAAAAGTATCAGGAGGCGATGCGGCAATACCGCTCAGTAGAGCCGCAGGTGCTCAAATCGCCGA
CGCCAGCGGTTCGATGCCAGCGGCCTACGTAAACGGTGGATATTTCAATATGGGAGCCAGGCAAGCCATGTCCGGACCTT
TACCATTGCCATCCCCCCAACTTCAAAACCTGGAATACGCGTCAGTGGGAGGGAACGTTATCGACAGCCTTCAAAAGCCT
TTTATCGACCCGCCTGACGACTACAGTTCAGCTTATTCAAAACTGCAGCTAGGAGACGGTTCATTCATTCATGTGGCCCC
CAAACTGACAACAGGAGGCGTCATGCAGTTTTCACGCAGAGACAGCCTTAAAACAAAACACATCTATGGCGAAGAAACGG
GCCACGTGGGCGCTTTAGGTCATGCCAGCGACCCCAATGCGCGCTCAGCGATCAGCCTCGCAGAAAACAACACAGCCAGA
ACTCGTCTGGCTATCGCGCTTAACCAGGGCCGAGGCACCTTTAGTAGAAAAACCGATGAGCCTGGTTTCACGATGCTTGA
ATGGGCGACCGTCATGGCTCGACTGGACAACCTGAACCCTATAAATGAAAGAGGCCCACCCGCCGCCTCATCCTGGAATC
TCGACGGTGGCGATTCGTCAACGCTTGGCGTGCTGGATCCTTCCGGCACGCACCTGCTGCAGGTCCACACGCTGAAATAC
GGCAGAAGCGGCGTCAAATCGGCCAGACCGATAGGAAACTTCCTGACATTCCATCGGTAA

2019-2022 IPB, CAMS&PUMC