Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

DXK93_29575


Source  Achromobacter sp. K91 NODE_56_length_24304_cov_25.478_ID_111, whole genome shotgun sequence.
Protein accession  RII99677.1
TC component  C (Show this TC locus)
Start  12621
End  16508
Strand  +
Product  RHS repeat protein
Protein
(HVR is highlighted in red)
MNDCVPEIKGVLETTTGSPEGHGSSMHSSCLFCGIRYMSSLCAGTPKITVRDNRGLTVRTLRYNRSASSDVATQYVDAQD
YNDLGQTISSRDARFFAEGKGTLNFQYTPALSGQVLQTVSVDAGTSQAFADIEGHPVWESSQGRDCLYQSDDQFTTTHQY
DALGRPTARSVKIQRLSGGLASNVQTDIWVYGEALSLPAGAYDPSSPADPRNLNLRATLLKHYDTAGILDMAARGYQVQG
SAQRQDRQLLTISNAFDGVTHSWTGTYPNVNTSVVDPQVYSTAWIYNALSQVLNQTDAKGHQQQTTYDMAGRKASSSVTP
NGGKNTPVVADITYTADGQIETQSDANDIQTTYSYEQQTTRRVLSITTTRSAAAASAARKRRPQRRATSRSGRRSRASNW
TLLQDLSYTYDGVGNVTALSDASMPVAYHANGTVDGNRSYTYDALYQLLSASGRENYVSSNPSTTDSPSAYTPLDQANYR
SYTRNYQYDLGGNLCQIAAGNASGMGAAVPTRNMVVAAGSNHAVSNANNVGLTAAQVDSFFDRAGQNTCLDGNINQPMYW
TPYKQLYCVVTTYRESMYSGGDWFSSDCELYAYDSEGQRVRKAAQTASMGTWANDAIYLPGLEVRQNHQTGEQLEVIVLD
DGARMLNWTANPPSSIGNQQIRYRYGDRQNSCQIETDDRAQIITQEEYYPYGGTAVWAAASTSEAKYKTIRYSGKERDAA
GLYYYGMRYYQPWIGRWINPDPAGTVDGQNLYCMVGNNPVTSSDGTGLMAKKEDTEQREQAAASSAAADRPSTSTNTSLL
TVDTSVAQDISGPEFASPSKVFSELTVQSEGDAGRIARKRFSNLSDDTDGPSAKRARQDAIDSRNTIMKYLKENPGIGFA
RLENDRLVYHSESPEFEAAARSLLGSRNSAGSIADAQDTKDIRQVRVMEICQAQGALVVALQRETSAHLKQLDADFAPTA
SLMKSLEDELKPLLKGKNAQNINAKRIGEINEKLKPLFPKRADNERERNRVLNEMSLIGNILSSTHNKRTAINNERQRAS
FAINLAGVFKTAASAQKSKGFAFATFGTQKAFWFLGSAVNIKMNPKEFKTYAPKKASSGIAGDKKLYFNKFEPSELPAHF
EELDKHLVENNYSKLHAYTKHRIAGFNAKETQASDLQGEAYIGERQHINRAGVPGTHAESILFNELLHAFYPESQNTDFD
TIESEMGAGLLNNLKIYTFYLIDPQEGGYHLFEACQGCSAIIGDGINAINGKGTLAYNKVAEMIEEMRSMGIADNPDAIS
EHLISMKVPYQINFR
HVR cluster:
putative toxin domain
 TCHC_001:
 Unknown
DNA ATGAACGATTGCGTACCCGAAATCAAAGGCGTTTTGGAAACGACCACAGGTAGCCCTGAAGGTCATGGAAGTAGCATGCA
CTCATCCTGCCTTTTTTGCGGAATACGCTATATGAGCAGCTTGTGCGCGGGGACTCCCAAGATTACGGTGCGCGACAACC
GCGGCCTGACGGTGCGCACGCTGCGCTATAACCGCAGCGCGTCTAGCGATGTAGCCACGCAGTACGTGGACGCACAAGAC
TACAACGATCTTGGGCAGACAATTTCCAGCCGGGACGCGCGCTTCTTTGCCGAAGGCAAAGGTACCCTCAATTTTCAGTA
CACCCCGGCGCTGTCCGGCCAGGTGCTGCAGACGGTTAGCGTGGACGCTGGCACGAGCCAGGCGTTTGCTGATATCGAGG
GGCATCCGGTCTGGGAGAGCAGTCAGGGCCGCGATTGCCTGTATCAGTCCGACGACCAGTTCACTACCACGCATCAATAC
GACGCGTTGGGTCGCCCGACCGCGCGTTCGGTCAAGATCCAGCGCCTGTCGGGCGGGCTTGCCAGCAATGTCCAAACGGA
CATCTGGGTGTATGGAGAAGCCCTGAGCTTGCCGGCAGGCGCCTATGATCCGTCGAGCCCGGCCGACCCGCGCAACCTGA
ACTTGCGCGCGACCCTGCTCAAGCACTACGACACGGCCGGCATTCTAGACATGGCCGCGCGCGGCTATCAGGTGCAAGGC
AGCGCGCAGCGTCAGGATCGCCAGTTGTTGACGATAAGCAACGCGTTCGATGGCGTGACCCATAGCTGGACGGGGACGTA
TCCCAACGTCAATACCTCCGTGGTCGATCCCCAGGTGTATAGCACCGCCTGGATCTACAACGCATTGTCCCAGGTGCTCA
ACCAGACAGACGCCAAGGGCCATCAACAGCAGACGACATACGACATGGCCGGGCGCAAGGCATCAAGCTCTGTGACGCCC
AACGGAGGCAAGAACACGCCGGTCGTCGCTGACATCACCTACACGGCGGACGGCCAGATAGAAACCCAGAGCGACGCCAA
CGACATTCAAACGACGTACAGCTACGAGCAGCAGACCACGCGGCGGGTGCTATCGATCACGACCACACGCAGCGCAGCGG
CTGCCAGCGCGGCCAGGAAACGCCGCCCCCAACGTCGAGCCACGAGCCGCTCGGGCAGACGAAGCCGCGCGAGCAACTGG
ACGCTGCTGCAGGACCTCTCTTATACCTACGACGGGGTGGGCAACGTCACGGCGCTCAGCGACGCGAGCATGCCGGTGGC
GTACCACGCCAATGGCACAGTCGACGGAAACCGCAGCTATACCTATGACGCGCTCTATCAACTGCTCTCGGCGAGCGGGC
GCGAGAACTATGTGAGCAGCAATCCATCGACCACCGACTCGCCCAGCGCCTATACCCCGCTGGACCAGGCCAATTACCGT
AGCTACACACGCAATTACCAGTATGACCTCGGCGGCAATCTCTGCCAGATTGCAGCCGGCAATGCATCAGGCATGGGAGC
GGCCGTACCCACGCGCAACATGGTCGTGGCAGCGGGCAGCAACCACGCAGTGAGCAATGCGAACAATGTCGGTTTGACGG
CGGCGCAAGTGGACAGCTTTTTCGACCGCGCGGGCCAGAATACCTGCCTGGACGGCAATATCAATCAGCCAATGTACTGG
ACACCCTATAAGCAACTCTATTGCGTGGTCACCACGTATCGGGAATCCATGTATTCCGGCGGAGATTGGTTCTCGAGCGA
TTGCGAACTGTACGCCTACGACAGCGAGGGCCAGCGCGTGCGCAAGGCGGCACAGACAGCTTCCATGGGCACTTGGGCCA
ACGATGCAATTTATTTGCCCGGTCTGGAGGTGCGTCAGAACCACCAGACGGGCGAGCAACTCGAGGTGATTGTGCTCGAT
GACGGGGCGCGCATGCTGAACTGGACGGCCAACCCGCCGTCGAGCATTGGCAACCAGCAGATCCGCTACCGCTACGGCGA
CCGGCAGAACTCCTGCCAAATCGAGACCGACGACAGGGCGCAGATCATCACGCAAGAGGAGTACTACCCGTATGGCGGCA
CTGCGGTGTGGGCCGCGGCCTCGACCAGCGAAGCCAAGTACAAGACCATACGCTACTCGGGCAAGGAGCGTGACGCCGCA
GGCCTCTATTACTACGGCATGCGCTACTACCAGCCGTGGATCGGACGTTGGATCAATCCGGATCCGGCCGGCACGGTGGA
TGGACAGAATCTGTACTGTATGGTGGGGAATAATCCGGTCACCTCGTCGGATGGGACTGGGCTGATGGCCAAAAAGGAAG
ACACCGAGCAACGCGAACAAGCGGCTGCATCATCCGCCGCCGCTGATAGACCTAGCACGTCAACTAACACCTCGCTGCTC
ACGGTCGACACCAGCGTGGCACAGGACATATCTGGACCGGAATTCGCGTCACCGTCAAAAGTGTTTTCCGAACTAACCGT
TCAGTCCGAAGGGGATGCAGGACGCATCGCCCGGAAGCGCTTTTCCAACCTCAGCGATGACACGGATGGACCTAGCGCCA
AAAGAGCCCGCCAGGATGCCATCGATAGCCGAAACACCATCATGAAATACCTGAAGGAGAACCCGGGCATCGGATTTGCA
CGGTTAGAGAATGACCGGCTTGTATACCACTCAGAGTCCCCCGAATTTGAGGCTGCCGCCCGCAGTCTACTTGGGAGCCG
AAATAGTGCGGGCTCGATCGCCGACGCACAAGATACTAAAGATATAAGGCAGGTTCGAGTAATGGAGATTTGTCAAGCCC
AGGGAGCACTGGTGGTGGCGTTGCAGCGTGAAACCTCCGCACATCTCAAACAGCTTGACGCAGATTTCGCCCCGACCGCT
AGTCTAATGAAGTCGCTCGAAGATGAACTCAAACCCCTGCTAAAGGGAAAAAATGCACAAAATATAAATGCAAAAAGGAT
CGGCGAAATTAATGAGAAATTGAAACCCCTTTTTCCGAAGAGGGCTGACAATGAAAGGGAGAGGAACCGAGTTTTGAATG
AAATGAGTCTTATCGGAAACATTCTTAGTTCGACGCATAATAAACGAACCGCCATCAACAACGAACGGCAACGCGCCTCG
TTCGCCATCAATCTCGCGGGCGTATTCAAAACAGCGGCGAGTGCTCAGAAGTCAAAGGGATTCGCATTCGCCACTTTCGG
AACACAAAAGGCGTTTTGGTTCCTGGGCTCGGCCGTAAATATTAAAATGAACCCCAAGGAATTTAAAACGTACGCACCCA
AAAAAGCCTCCTCCGGAATAGCGGGTGATAAAAAATTGTATTTCAACAAATTCGAGCCAAGTGAATTGCCGGCGCATTTC
GAAGAGCTTGACAAACATCTCGTAGAAAATAACTACAGCAAGCTCCATGCGTATACGAAACATAGAATTGCTGGATTCAA
TGCAAAAGAAACGCAGGCATCTGACCTTCAAGGTGAGGCTTATATTGGAGAGCGACAACACATCAATCGTGCGGGAGTGC
CGGGCACGCACGCGGAGTCCATTTTGTTCAATGAGTTGCTCCACGCTTTTTATCCTGAAAGTCAGAACACTGATTTTGAT
ACCATAGAAAGTGAAATGGGGGCAGGACTGCTGAATAATTTGAAAATTTATACTTTTTACCTTATTGATCCACAGGAGGG
AGGGTATCATCTATTTGAGGCATGCCAGGGATGCTCCGCGATCATTGGCGACGGAATTAATGCGATAAACGGCAAGGGCA
CATTGGCGTACAACAAGGTAGCGGAAATGATAGAAGAAATGCGGAGTATGGGCATTGCCGATAATCCGGACGCCATCTCG
GAGCATCTGATCAGTATGAAAGTCCCGTATCAGATTAATTTCAGGTAA

2019-2022 IPB, CAMS&PUMC