Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

ENSA7_54600


Source  Enhygromyxa salina strain SWB007 ENSA7_contig000111, whole genome shotgun sequence.
Protein accession  PRQ02631.1
TC component  C (Show this TC locus)
Gene  wapA_10
Start  21477
End  24041
Strand  +
Product  tRNA3(Ser)-specific nuclease WapA precursor
Protein
(HVR is highlighted in red)
MATAAAPSLETTVYTSSSTHDALGRVLTAISPDGSEVAYTYNQRGALKTVDCKHRGALTSTPVVAEITYDVRGRRESITH
AANSTTTSYSYDPLNFRLRSIETTRASDSKKLQGLHYHHDPVGNVTDIRDDAQQTVYFQNAIVEAANSYTYDALYRLVEA
TGREHATQGTAQRSSTQLLPDSSAVPMANDPNALRRYTQSYTYDAVGNLETVVHAPASGTGWTRRYQYRTDGNRLVGTSA
PGDSAGALYTNTATYSHTYPHDEHGNFTAMPHMSAMAWDELDQLHHCTVGSQEVYFQYAGGQRVRKYVEHAGATTEERIY
LGSFELYRKRVNGALVNGTLKEEWESLHVSDDTGRILLVETHTVDDGDVVGSPTGIWRFQLSNHLGSAATEVSESGAVIS
YEEYHPYGTSAYRLVDSQIDVPAKRYRYTGMERDEETGLGYHTARYYAPWLGRWTASDPIGLSGGINQFEYSASSPLVLS
DQAGTSPHQLGDNISVDQVEDWKSDSSLIAPGATPVLIAGTDDRYLVIPTESIFARPGERAEEGHFAWAFTPSFAGQAWG
KKYAHAVQEIADNRETAAAAQQILASNKMIAAFGLGGGATVAGGLSGGLALKLGLPLIGTALGSSILGGATTGWTLEGGL
ALLDGQSPGEALARANRGGLVGGALGGAGYFAGRGIGWGLSKLRGGAPSTTQTAFQQGMPLIRAVRPAPSTLPPGGSSAA
GEIDAAVGAEVEVTVDAAELHGLFYHQVNKGGLDEIVESQILRVSEANSRGYGEAIRAYPGEATGTGGQGVVKFYTYEAP
HYVKPILNPGWGGNATKPLAEVRWTNVESIGIRLRRVFYPDGRAIWFLKPPPPP
HVR cluster:
putative toxin domain
 TCHC_004:
 PLN02720 superfamily (complex II) ==>>
DNA ATGGCGACCGCCGCCGCGCCCTCGCTCGAGACGACCGTGTACACGTCGTCGAGCACCCACGACGCGCTCGGCCGGGTCCT
CACCGCGATCTCGCCCGACGGCTCGGAGGTCGCGTACACCTACAACCAGCGCGGCGCGCTGAAGACCGTCGACTGCAAGC
ACCGCGGCGCGCTCACGTCGACGCCCGTGGTCGCGGAGATCACGTACGACGTCCGCGGCCGGCGAGAGTCGATCACCCAC
GCCGCCAACTCCACAACGACCAGCTACAGCTACGACCCGCTGAACTTCCGCCTGCGCTCGATCGAGACCACCCGCGCGAG
CGACAGCAAGAAGCTGCAGGGTCTCCACTATCACCACGATCCAGTCGGCAACGTCACGGACATCCGCGACGACGCGCAGC
AGACGGTCTATTTCCAGAACGCGATCGTCGAGGCCGCGAACAGCTACACCTACGACGCGCTCTACCGGCTGGTCGAGGCG
ACCGGCCGCGAGCACGCCACGCAGGGCACGGCGCAGCGGAGCTCGACGCAGCTGCTGCCAGACAGCAGCGCGGTGCCGAT
GGCGAACGACCCCAACGCGCTGCGGCGGTACACGCAGAGCTACACGTACGACGCCGTGGGCAACCTCGAGACGGTCGTCC
ACGCGCCCGCGAGCGGGACGGGCTGGACGCGGCGGTACCAGTACCGGACCGACGGCAACCGGCTCGTGGGCACCAGCGCC
CCCGGGGACTCGGCCGGGGCGCTCTACACGAACACGGCCACGTACAGCCACACCTACCCGCACGACGAGCACGGCAACTT
CACCGCGATGCCGCACATGTCGGCGATGGCGTGGGACGAACTCGACCAGCTGCACCACTGCACGGTGGGGTCGCAGGAGG
TGTACTTCCAGTACGCGGGCGGGCAGCGGGTCCGCAAGTATGTGGAGCACGCGGGAGCGACGACCGAAGAGCGAATCTAC
CTGGGTAGCTTCGAGCTGTACCGCAAGCGGGTCAACGGCGCGCTGGTCAACGGGACGCTGAAGGAGGAGTGGGAGTCGCT
GCACGTCAGCGACGACACCGGGCGGATCTTGCTCGTCGAGACGCACACGGTGGACGACGGCGACGTCGTTGGGAGCCCGA
CGGGGATCTGGCGGTTTCAGCTGAGCAACCACCTGGGCTCGGCGGCGACGGAGGTCAGCGAGAGTGGGGCGGTGATCTCG
TACGAGGAGTATCACCCGTATGGCACGAGCGCGTATCGGCTGGTCGACAGTCAGATCGACGTACCGGCGAAGCGGTACCG
CTACACGGGGATGGAGCGGGACGAAGAGACGGGGCTTGGGTACCACACGGCGCGGTATTATGCGCCGTGGTTGGGGCGGT
GGACCGCCAGCGATCCGATCGGACTGAGTGGCGGCATCAATCAGTTCGAATACTCAGCGTCGAGTCCCCTCGTTCTCAGC
GATCAAGCGGGGACATCACCGCATCAGTTGGGCGACAACATTTCAGTTGACCAGGTCGAGGACTGGAAGAGTGATAGCTC
TCTCATTGCGCCTGGTGCCACGCCGGTCTTGATAGCGGGCACGGATGACCGCTACCTGGTCATTCCCACCGAGTCGATCT
TCGCACGACCCGGAGAACGTGCGGAAGAAGGGCACTTTGCGTGGGCATTTACGCCCAGTTTCGCGGGGCAAGCGTGGGGG
AAGAAGTACGCGCATGCTGTACAGGAGATCGCCGACAACAGGGAAACCGCTGCGGCAGCGCAACAGATTCTTGCGTCGAA
CAAGATGATAGCAGCTTTCGGCCTTGGCGGCGGTGCCACTGTGGCCGGTGGCCTCAGCGGTGGGTTGGCGCTAAAACTAG
GCTTGCCCCTAATCGGCACTGCACTGGGCAGTTCCATCCTCGGCGGCGCCACAACCGGTTGGACTCTCGAAGGCGGGCTA
GCGTTGTTAGACGGGCAGTCACCGGGAGAGGCGCTCGCGCGTGCGAACCGAGGAGGGCTGGTTGGTGGTGCACTCGGTGG
CGCTGGCTATTTTGCCGGTCGAGGTATTGGGTGGGGGCTTTCGAAGTTGCGTGGCGGAGCACCCTCTACTACGCAAACTG
CATTCCAGCAAGGCATGCCACTCATCCGTGCAGTTCGACCGGCGCCGAGCACATTGCCACCAGGGGGGAGCTCCGCCGCC
GGCGAGATCGATGCGGCGGTCGGTGCAGAAGTTGAGGTCACAGTTGACGCAGCAGAACTACATGGGTTATTTTATCATCA
AGTCAACAAAGGTGGGCTCGACGAGATTGTAGAGTCGCAGATTTTAAGGGTTTCGGAAGCAAATAGTCGTGGCTACGGCG
AAGCGATTCGGGCATACCCTGGCGAGGCCACCGGGACAGGTGGTCAAGGCGTTGTCAAGTTTTACACCTACGAAGCTCCC
CACTACGTCAAGCCAATTTTGAATCCAGGGTGGGGAGGCAATGCCACAAAGCCTTTGGCAGAGGTCAGGTGGACAAACGT
GGAAAGCATTGGCATACGTCTGCGACGTGTGTTTTATCCGGATGGCCGAGCGATCTGGTTCCTCAAACCGCCCCCGCCTC
CATAA

2019-2022 IPB, CAMS&PUMC