Introduction Browse by taxonomy Browse by HVR cluster Browse by HVR function/domain List of orphan TcC Search dbTC  

ENSA7_36640


Source  Enhygromyxa salina strain SWB007 ENSA7_contig000070, whole genome shotgun sequence.
Protein accession  PRQ06643.1
TC component  C (Show this TC locus)
Gene  wapA_7
Start  15851
End  18613
Strand  -
Product  tRNA(Glu)-specific nuclease WapA precursor
Protein
(HVR is highlighted in red)
MHSWDARDQRFSFSYDTLRRPVDRTVSVGGGAEKLLGRVVYGDLLASPEATNHRGRVYRVYDGAGVATSLAYDFKGQPTS
EQRQLVAGKTTQPDWSALLSQSTIAAMATAAAPLLDTEIFSASSERDALGRVLKAISPDNSEALYTYDQAGALQKVELKH
RGGDTVETVVGSISYNARGQRETVIYGPASSPTTTTSYTYDPKTYRLARLSTLRGSDNASLQGLHYHYDPAGNITDIRDT
AQQTVYFQNAVVEAANSYEYDATYRLIEATGREHATQGTTQRTHEQLPVGPQPMASDPSAMRRYTQRYTYDGVGNILKMQ
HIPAAGTGWTRRYEYAHDGNRLLATSAPGDAANGPYTHTYTYDAHGSMTTMPHLAAMDWDHDDQLQHATAGTEQVYFQYA
GGIRSRKFTEKQGSTTEERIYLGPFEIYRKRKRINGTLDLERESLHISDGSGRICIVETKHVDDGVPDMGALAIWRYQLS
NHLGSAATEVDGNGAVISYEEYHPYGTSAYRAVNSSVDSSAKRYRYTGMERDEETGLGYHSARLYLPWIARWTAADPVGM
GDGVNRFGYVGGRPIGSVDTAGCSEVEAWVNTAVASTAQAAIRAAVKSGASARGLAKVSSSAANRIAHQSYSNDDGGGGD
PDTGHEGSGEGDDVISDSPSVVRKKTIGEYEAEAYRAWEQQFDAADSTYYDRPLIIDFIPLIGVRDFQHDTRQLGDAIWM
GDGERAANAAAHVGIDVVMSVVDVATLGADRLALGAFKMWSRAPRGTLGLAAHGGNGEMRNELKAAARDTGPLSTTDEGR
MLHRGMREATGTPEAGPSARSLGVRPDIDLPVVDGMVKPNTGGMSVAPDAPTNLPRHRRPPELGGTGKDPVFSINEKSLG
PDLNFRQDKGSHGIIEPAREMKIEEFQQALARIKALWTKL
HVR cluster:
putative toxin domain
 TCHC_011:
 Unknown
DNA ATGCACAGCTGGGACGCTCGGGACCAGCGCTTTTCCTTCAGCTATGACACTCTGCGCCGCCCGGTTGATCGCACCGTGAG
CGTCGGCGGTGGCGCTGAAAAACTGCTCGGTCGCGTCGTCTACGGTGATCTGCTCGCGTCGCCCGAGGCCACGAACCACC
GTGGTCGCGTGTACCGAGTCTACGACGGCGCAGGAGTTGCGACCTCGCTGGCCTACGACTTCAAGGGGCAGCCAACATCC
GAGCAACGCCAGCTCGTCGCCGGCAAGACCACCCAGCCCGACTGGAGTGCTCTGCTCAGCCAAAGTACAATTGCCGCGAT
GGCCACCGCCGCCGCACCGCTGCTGGACACCGAGATCTTCTCGGCATCCAGCGAACGCGACGCCCTCGGCCGCGTGCTGA
AGGCCATCTCGCCGGACAACAGTGAGGCCCTCTACACCTACGACCAGGCCGGCGCCCTACAGAAGGTGGAGCTCAAACAC
CGCGGCGGTGACACCGTCGAGACCGTGGTCGGGTCCATCAGCTACAACGCCCGCGGCCAGCGTGAGACCGTCATCTACGG
CCCGGCCAGTTCGCCGACCACGACGACCTCGTACACCTACGACCCCAAGACCTACCGCCTCGCGCGGCTGTCCACGCTCC
GCGGCAGCGACAACGCATCGCTCCAGGGCCTGCACTACCACTACGATCCTGCCGGCAACATCACGGACATCCGCGACACC
GCCCAGCAGACGGTCTACTTCCAGAACGCCGTCGTCGAGGCCGCCAACTCCTACGAGTACGACGCCACCTACCGCTTGAT
CGAAGCGACCGGGCGCGAGCACGCCACCCAAGGCACGACCCAGCGCACCCACGAGCAGCTCCCCGTCGGCCCGCAGCCGA
TGGCCTCCGACCCGTCCGCGATGCGCCGCTACACGCAGCGCTACACCTATGACGGCGTCGGCAATATCCTGAAGATGCAG
CACATCCCCGCCGCGGGGACCGGCTGGACGCGTCGCTACGAATACGCCCATGACGGCAACCGCCTGCTCGCGACGTCGGC
CCCGGGCGACGCCGCTAACGGCCCGTACACGCACACATACACCTACGACGCCCACGGGAGCATGACGACCATGCCGCACC
TCGCGGCGATGGACTGGGACCACGATGACCAGCTCCAGCACGCCACCGCTGGCACGGAGCAGGTCTACTTTCAGTACGCG
GGCGGGATCAGGAGCCGCAAGTTTACCGAGAAGCAGGGGAGCACGACCGAAGAGCGCATCTACCTCGGGCCTTTCGAGAT
CTACCGCAAGCGCAAGCGCATCAACGGCACGCTGGACCTCGAGCGCGAGTCACTGCACATCAGCGATGGTAGCGGCCGGA
TCTGTATCGTCGAAACCAAGCACGTAGATGACGGCGTGCCTGATATGGGCGCGCTCGCCATCTGGCGCTACCAGCTGAGC
AACCACCTCGGCTCCGCCGCAACAGAGGTCGACGGCAACGGCGCGGTCATCTCGTACGAGGAGTACCACCCTTACGGCAC
GAGCGCGTATCGGGCGGTAAACTCGAGCGTGGACTCGAGCGCGAAGCGGTATCGGTATACGGGGATGGAGAGGGACGAGG
AGACGGGGCTAGGCTACCACTCCGCGCGACTCTATCTTCCTTGGATCGCCCGATGGACAGCCGCCGATCCGGTGGGCATG
GGCGACGGAGTGAACAGGTTTGGGTACGTCGGTGGTCGTCCGATCGGTAGTGTAGATACTGCGGGATGCTCCGAAGTGGA
GGCTTGGGTCAACACGGCCGTCGCGTCAACTGCACAGGCTGCGATTCGTGCGGCCGTGAAGTCGGGAGCGTCGGCACGCG
GCCTCGCTAAAGTATCGAGTTCGGCAGCAAACCGGATTGCACATCAGTCCTACTCCAATGATGATGGCGGTGGGGGTGAC
CCGGACACAGGACATGAGGGATCTGGGGAGGGCGACGACGTGATTTCGGATTCACCCTCCGTCGTGCGGAAGAAAACCAT
TGGCGAGTATGAAGCTGAGGCCTACCGCGCATGGGAGCAACAATTCGATGCAGCAGATTCTACCTACTATGACCGGCCCC
TGATTATTGACTTCATCCCATTAATCGGAGTGCGAGACTTTCAGCACGACACGCGTCAACTCGGTGACGCGATCTGGATG
GGAGACGGAGAGCGCGCCGCGAACGCCGCTGCGCATGTCGGGATTGACGTGGTGATGTCCGTAGTTGATGTTGCCACCCT
TGGCGCTGACCGTCTTGCGCTAGGCGCATTCAAGATGTGGAGCCGCGCGCCGCGCGGGACCCTGGGACTCGCGGCTCACG
GTGGCAACGGGGAGATGCGAAATGAGCTGAAGGCCGCTGCGCGGGATACAGGTCCCCTATCCACCACCGACGAGGGGCGA
ATGCTGCACCGCGGAATGCGGGAAGCTACAGGAACTCCCGAAGCTGGCCCGTCAGCCCGTTCTCTTGGAGTTCGCCCAGA
CATCGATCTTCCGGTGGTCGATGGCATGGTGAAACCAAATACGGGCGGAATGTCTGTTGCTCCTGACGCACCAACAAATC
TACCGCGTCATCGACGCCCACCCGAATTAGGTGGTACAGGCAAAGATCCGGTGTTTTCGATAAATGAGAAAAGCCTTGGC
CCCGATCTCAACTTTCGACAGGATAAGGGAAGCCATGGTATCATTGAACCTGCCCGTGAAATGAAGATCGAGGAGTTCCA
GCAGGCCCTCGCTCGGATCAAGGCACTGTGGACGAAACTGTGA

2019-2022 IPB, CAMS&PUMC